DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: His3:CG31613 and His3.3A

Sequence 1:NP_724345.1 Gene:His3:CG31613 FlyBaseID:FBgn0051613 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_001260082.1 Gene:His3.3A FlyBaseID:FBgn0014857 Length:136 Species:Drosophila melanogaster

Alignment Length:136 Identity:132/137 (96%)
Similarity:135/137 (99%) Gaps:0/137 (0%)


  Fly     1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRK 65
            |||||||||||||||||||||||||||||||:|||||||||||||||||||||||||||||||||
  Fly     1 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRK 65

  Fly    66 LPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARR 130
            ||||||||||||||||||||||:|:.|||||||||||||||||||||||||||||||||||||||
  Fly    66 LPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARR 130

  Fly   131 IRGERA 136
            ||||||
  Fly   131 IRGERA 136

Known Domains:


GeneSequenceDomainRegion External IDIdentity
His3:CG31613NP_724345.1 PTZ00018 1..136 CDD:185400 131/135 (97%)
His3.3ANP_001260082.1 PTZ00018 1..136 CDD:185400 131/135 (97%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C23804
eggNOG 1 0.900 E2759_KOG1745
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000019
orthoMCL 1 0.900 OOG5_126569
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
43.730

Return to query results.
Submit another query.