DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG43394 and VWA7

Sequence 1:NP_001245938.1 Gene:CG43394 FlyBaseID:FBgn0263256 Length:948 Species:Drosophila melanogaster
Sequence 2:XP_005249484.1 Gene:VWA7 HGNCID:13939 Length:917 Species:Homo sapiens

Alignment Length:696 Identity:153/697 (22%)
Similarity:232/697 (33%) Gaps:181/697 (26%)


  Fly   254 GFPWAT-----TQAPSPPTTSSTSSTTTTSTTTTTTTTSTTTTPSPRKQPKHIQVTGGLKPELLP 313
            ||...|     |..|.||...|.......|::..........:.||...|.|:......|..||.
Human   223 GFTLLTSGYFGTHPPKPPGKCSHGGHFDRSSSQPPRGGINKDSTSPGFSPHHMLHLQAAKLALLA 287

  Fly   314 ADQLRNYIK------------DVYIRMPLAVIVDPS-------SASLEQAKRLYIDALQDKNIDI 359
            :.|..:.::            |:.....|:.::|.:       :|:..||:.|...........:
Human   288 SIQAFSLLRSRLGDRDFSRLLDITPASSLSFVLDTTGSMGEEINAAKIQARHLVEQRRGSPMEPV 352

  Fly   360 KIVLVTLNAAGAPSAFSFNNTREFIAGLNSTKEHEGGNSFVGVLHAAEL----VPYDSAVFISTA 420
            ..|||..:..|....|:.::...|...||......||:.....|.|.:|    .|..|.:|:.|.
Human   353 HYVLVPFHDPGFGPVFTTSDPDSFWQQLNEIHALGGGDEPEMCLSALQLALLHTPPLSDIFVFTD 417

  Fly   421 VIPPHTELVQDAAITLLKKRIRL-FLLWYGERSGSENETEDA--VGG-----ILG--------EV 469
            ..|....|.........::|.|: ||:           |||.  |.|     ||.        .|
Human   418 ASPKDAFLTNQVESLTQERRCRVTFLV-----------TEDTSRVQGRARREILSPLRFEPYKAV 471

  Fly   470 AIRSGGEII-----HI--VSTEHGQHIAG-NTLTLVADAYQGSQELDLPVDTTLSSLHVRIDANM 526
            |:.||||:|     ||  |:...|:.:|. .||.|........|.|...||..|..:.|||..::
Human   472 ALASGGEVIFTKDQHIRDVAAIVGESMAALVTLPLDPPVVVPGQPLVFSVDGLLQKITVRIHGDI 536

  Fly   527 RRATMETPNGEINLKKLAKFGGVNVTETLNNQELDAYVPLNKLRRASIFKL------------KL 579
            ....::.|.|                  ::..:.:...||...||...|.:            ::
Human   537 SSFWIKNPAG------------------VSQGQEEGGGPLGHTRRFGQFWMVTMDDPPQTGTWEI 583

  Fly   580 QPELHDKYNVFVRAERKADVFLGDIIKRID----SYYKTGQTKAKSAKLQFPDKEKDTEKLEEDV 640
            |....|...|.|:|:...|......|...|    ..|...|          |.....|:.|.|..
Human   584 QVTAEDTPGVRVQAQTSLDFLFHFGIPMEDGPHPGLYPLTQ----------PVAGLQTQLLVEVT 638

  Fly   641 D-----SPKNEIETFSEQEIQSSP-----------------------NLNQTLLAPS-------T 670
            .     :|.:....||...::..|                       :|:.|||:..       .
Human   639 GLGSRANPGDPQPHFSHVILRGVPEGAELGQVPLEPVGPPERGLLAASLSPTLLSTPRPFSLELI 703

  Fly   671 GQSR------------STLNAMLLQ-RCGTKIELGIE---------SKLLVMAGQTATLL--FEV 711
            ||..            ||:..:||: |...|:.||:|         :..|.::|.:..|.  .:|
Human   704 GQDAAGRRLHRAAPQPSTVVPVLLEVRRQGKVRLGLERVRAAPSLKNPSLQLSGPSGFLAPGSKV 768

  Fly   712 TNMKTETVYSTIQVTDERRFL-----VQLNPTRLSLRAQETATVRLTVLVPTGTAQGTTDRITFT 771
            ........:|..|..|.|.|:     :..|.:|..|...|:|..||.:.||...|..:...:|.|
Human   769 PLSLRIASFSGPQDLDLRTFVNPSFSLTSNLSRAHLELNESAWGRLWLEVPDSAAPDSVVMVTVT 833

  Fly   772 NYGRETSTLAVN---LKVVTSIDA-QD-STGPTLSWEFGSRCDYLT 812
            ..|||.:.:...   |:::.|..| || .|.||     ||....||
Human   834 AGGREANPVPPTHAFLRLLVSAPAPQDRHTTPT-----GSSDPILT 874

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG43394NP_001245938.1 None
VWA7XP_005249484.1 Het-C <163..>190 CDD:284602
vWFA 318..496 CDD:294047 46/189 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.