DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG43394 and 1810055G02Rik

Sequence 1:NP_001245938.1 Gene:CG43394 FlyBaseID:FBgn0263256 Length:948 Species:Drosophila melanogaster
Sequence 2:NP_001345185.1 Gene:1810055G02Rik MGIID:1919306 Length:392 Species:Mus musculus

Alignment Length:344 Identity:77/345 (22%)
Similarity:108/345 (31%) Gaps:104/345 (30%)


  Fly     3 LRTHLWLGVLLAALLLNTVVSGEDEDYGGEMIGSSLGGNDEIYDPAQLEAEVEKEMEQHRNSLEE 67
            |.|..|     ||.|.:|.|:.|...:|                                     
Mouse    67 LTTETW-----AATLNSTRVTAEVTTHG------------------------------------- 89

  Fly    68 DQTESSQVMELEVSTMRPMESRMNTMA-PYSGENSSAEMIDDASTQKRVSKV-DKPARDYYYEDA 130
              |.:|.....|.:|.| :.||  |:| |.|...||||       |.|.:.: ..|:....:.:.
Mouse    90 --TNTSTPTTREGTTDR-VTSR--TLAVPTSSGPSSAE-------QTRPTTIAGLPSLSTPHAEV 142

  Fly   131 PEDEMVASTTAKVATTMIPEYVRQAKAERFPQRDQEHTSTDYIEEDATKSVDEEPPADQFYRVEQ 195
            |......|....:|.|:.|.....|...  ......||        .|.|..:..|.|    ...
Mouse   143 PRTNASVSPRTAMAATVAPHTATLAAGT--VNTSDPHT--------RTPSPAKSTPTD----TSS 193

  Fly   196 HEPIPQ--AQVQ----QLPSRDKPKPFEYSSEDDYYDEHAEAKTTTTSTST-------------- 240
            ..|||.  ||:|    || :.|:| ....:........:|..:.|||...|              
Mouse   194 KNPIPTSGAQIQGTTVQL-TTDQP-VHSTAGRSALSPSNATLEPTTTQVQTKEPSASTVPARATS 256

  Fly   241 ----------TQAPLPILRARFGGFPWA--TTQAPSPPTTSSTSSTTTTSTTTTTTTTSTTTTPS 293
                      |..|.|.|..:..|.|..  ||:.....|||.|:|...||.::......||.:..
Mouse   257 LSPDVDVISPTTQPSPTLPTQGTGGPGTLLTTEQVGTKTTSGTASAGPTSRSSGDIKVPTTDSCQ 321

  Fly   294 PRKQPKHIQVTGGLKPELL 312
            |..|.:::.....|.|.|:
Mouse   322 PSTQGQYLVTIDALTPSLV 340

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG43394NP_001245938.1 None
1810055G02RikNP_001345185.1 Atrophin-1 <104..329 CDD:331285 60/251 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR16021
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.