DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43394 and Mansc4

DIOPT Version :9

Sequence 1:NP_001245938.1 Gene:CG43394 / 318843 FlyBaseID:FBgn0263256 Length:948 Species:Drosophila melanogaster
Sequence 2:XP_001077890.1 Gene:Mansc4 / 691362 RGDID:1585055 Length:339 Species:Rattus norvegicus


Alignment Length:345 Identity:75/345 - (21%)
Similarity:109/345 - (31%) Gaps:123/345 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   611 YY--KTGQTKAKSAKLQFPDKEKDTEKLEEDVDSPKNEIETFSEQEIQSS--------PNLNQTL 665
            ||  .|||...:|..|:            :||..   .:..|....|..:        |.|...:
  Rat    56 YYSENTGQKCGRSCCLR------------KDVSC---NVAVFFHDPIHDNVNCLHVHCPTLESCI 105

  Fly   666 LAPSTGQSRSTLNAMLLQRCGTKIELGIESKLLVMAGQTATLLFEVTNMKTE-----TVYSTIQV 725
            |.|.||       |:|.     .|..||:..|||......|  :..|...:|     .:...:..
  Rat   106 LEPGTG-------AILY-----NITAGIDPDLLVFEHSPPT--YPNTRSSSEWWDRLRILKAMNA 156

  Fly   726 TDERRFLVQLNPTRLSLRAQETATVRLTVLVPTGTAQGTTDR----ITFTNYGRETSTLAVNLKV 786
            .||..:...:|.|                 ||:..|..||..    .|..:|.|: ||..|.::.
  Rat   157 GDEGIYPDVMNHT-----------------VPSTEAASTTHHDLGANTGISYSRK-STADVGMRF 203

  Fly   787 VTS---IDAQDSTGPTLSWEFGSRCDYLTPESQNCGERFWTVDVTAQDWQSGMMRLQASPP---- 844
            .:|   .....||| :.|.:|..     :|:::.....|...|.......| ..||..|.|    
  Rat   204 TSSRVPTATNVSTG-SPSTDFTP-----SPDNKTISPFFGPTDTDVSQVPS-QSRLNISKPSVNK 261

  Fly   845 -EGLFYRNYYTAGSTEPLKATYMASCCEPKVSLIAFDAAGNQRSLTIDVRDVYLNEAAIAAICLG 908
             :|....| :|:.|.||...|       |.       :||                |.:|.:.||
  Rat   262 TKGSHSGN-HTSDSKEPRDGT-------PA-------SAG----------------AWLACVTLG 295

  Fly   909 VILLILLIAALIWSIVWCCR 928
            ..::.|           |||
  Rat   296 AAMVSL-----------CCR 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43394NP_001245938.1 None
Mansc4XP_001077890.1 MANEC 26..115 CDD:129004 18/80 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16021
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.