DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG43394 and wu:fa25f02

Sequence 1:NP_001245938.1 Gene:CG43394 FlyBaseID:FBgn0263256 Length:948 Species:Drosophila melanogaster
Sequence 2:XP_690904.4 Gene:wu:fa25f02 ZFINID:ZDB-GENE-030131-5281 Length:352 Species:Danio rerio

Alignment Length:270 Identity:61/271 (23%)
Similarity:88/271 (32%) Gaps:105/271 (39%)


  Fly   164 DQEHTSTDYIEEDATKSVDEEPPADQFYRVEQHEPIPQAQVQQLPSRDKPKPFEYSSEDDYYDEH 228
            :|:..|||.:..:.|::.:.|.|                 :|..|:::..:|...:|        
Zfish    99 EQDANSTDSVHVNKTQTDESELP-----------------LQSSPNQNSSQPTSNNS-------- 138

  Fly   229 AEAKTTTTSTSTTQAPLPILRARFGGFPWATTQAPSP------------------PTTSSTSSTT 275
             .:.||.|||..|......:......|....|.||:|                  |..:||..||
Zfish   139 -SSNTTQTSTPQTNVSNSTITPTATVFQNNITTAPTPTTPKPATTVAVPNITIPTPAITSTKPTT 202

  Fly   276 TTSTTTTTTTT---------------STTTTPSPRKQPKHIQVTGGLKP-ELLPADQLRNYIKDV 324
            |||.|||:|||               ||..:||....|..|.:|   || :..|.          
Zfish   203 TTSPTTTSTTTVAQTARQPSPTGTNSSTNISPSVPTTPPSIPLT---KPLQTSPT---------- 254

  Fly   325 YIRMPLAVIVDPSSASLEQAKRLYIDALQDKNIDIKIVLVTL------------NAAGAPSAFSF 377
                |.||...|...|:                ::.:|:.||            ..||.|.....
Zfish   255 ----PTAVEKPPPKTSM----------------NLPVVVPTLPKDVPKGGKAIVEVAGDPLTSHL 299

  Fly   378 NNTREFIAGL 387
            .||...:|.|
Zfish   300 LNTSSLLAVL 309



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR16021
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.