DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG43394 and vwa10.1

Sequence 1:NP_001245938.1 Gene:CG43394 FlyBaseID:FBgn0263256 Length:948 Species:Drosophila melanogaster
Sequence 2:XP_021332508.1 Gene:vwa10.1 ZFINID:ZDB-GENE-090313-291 Length:832 Species:Danio rerio

Alignment Length:737 Identity:139/738 (19%)
Similarity:246/738 (33%) Gaps:240/738 (33%)


  Fly   256 PWATTQAPSPPTTSSTSSTTTTSTTTTTTTTSTTTTP----------------SPRK-------- 296
            |::|...|..|.::.....|.|..:......:....|                :|:|        
Zfish   177 PYSTLIKPELPLSNLAGPNTKTCKSCVGDDCTDNILPEIIQQKLLTSGYFSLITPKKPAGKCSHG 241

  Fly   297 ----QPKHIQVTGGLKPELLPA---------------------DQLRNYIKDV-YIRM------- 328
                :..:.:.|||:..:.:.:                     :.:|..:.|: ::|:       
Zfish   242 GFFDRTSYTEPTGGINKDDIASSHGFLHQRAANMAINATMEMLEDIRLAVGDLAFLRLMGLTQTS 306

  Fly   329 PLAVIVDPS---SASLEQAKRL---YIDALQDKNID-IKIVLVTLNAAGAPSAFSFNNTREFIAG 386
            .||::.|.:   ||.:.:||.:   :||::...:.: .:.:||..:...|.|....:|...|...
Zfish   307 VLAIVFDSTGSLSAYIAEAKTMLFSFIDSIIGTSEEPSEYMLVLFSDLDAGSLIKTSNAETFKEQ 371

  Fly   387 LNSTK---EHEGGNSFVGVLHAAELVPYDSAVFISTAVIPPHTELVQ--DAAITLLKKRIRLFLL 446
            :||..   ....|.....:|.|...||..|.:|:.|......::|..  :|.|...|.::. |||
Zfish   372 INSLSLLVNSNPGMCLSALLLALTRVPPSSDIFVYTDGPAKDSQLKSSVEAMIQSTKSKVN-FLL 435

  Fly   447 WYG--ERSGSENETEDAVGGILGEVAIRSGGEIIHIVSTEHGQHIAGNTLTLVADAYQGSQELDL 509
            ...  .|:.|......:...:..::|..|||:.|.:..:...|     .:||:.|.....|...|
Zfish   436 TNPTLSRASSSKALSQSDIQLYRDLAHISGGQTIEVTLSTVSQ-----AITLIGDEITSGQVTIL 495

  Fly   510 PV--------------DTTLSSLHVRIDANMRRATMETPNGEINLKKLAKFGGVNVTETLNNQEL 560
            .|              |:|||::.|.|..:....|:.:|.            ||:.:.::....|
Zfish   496 QVNRNASQTESFSFVLDSTLSNVIVYITGDSPVFTLYSPT------------GVSQSSSVAAGPL 548

  Fly   561 DAYVPLNKLRRASIFKLKLQPELHDKYNVFVRAERKADVFLGDIIKRIDSYYKTGQTKAKSAKLQ 625
            .:.:.:|     |:.:|||                             :|...||:.|.      
Zfish   549 GSILTVN-----SLMRLKL-----------------------------NSNNLTGEWKI------ 573

  Fly   626 FPDKEKDTEKLEEDVDSPKNEIETFSEQEI-QSSPNL----------------NQTLLAPSTGQS 673
                         .|:||    .:::.:.| |||.|:                .|:...|.||: 
Zfish   574 -------------TVNSP----NSYTLKVIGQSSMNVLVYFVEIFQGGHGDSWGQSYTRPFTGR- 620

  Fly   674 RSTLNAMLLQRCGTKIELGIESKLLVMAGQTATLLFEVTNMKTETVYSTIQVTDERRFLVQ---- 734
                ||.|.........:.:...|||.|..:|.:...:..:.|......|....|..|:||    
Zfish   621 ----NATLFVSVTGGDSVTVTDVLLVEASGSAVVNGTIKAVGTTDFLVNIDTIPEWAFVVQLRGL 681

  Fly   735 LNPTRLSLRAQETATVRL-----TVLVPTG--TAQGTTDRITF----------------TNYG-- 774
            ||.:....|.|..:.::|     ||:..:.  |..|....|:|                ||.|  
Zfish   682 LNKSSTISRFQRQSPIQLKGSKITVVAQSQNVTQPGVPLNISFTVAANATGGNYIIRARTNQGFS 746

  Fly   775 -RETSTLAV--------NLKVVTSIDAQDSTGPTLSWEFGSRCDYLTPESQNCGERFWTVDVTAQ 830
             ..:|:|.|        |:.::|..|.:..|..|           ||.|::..|         :.
Zfish   747 VSVSSSLLVAAGGSAQGNITLITPSDTESGTDVT-----------LTIEAEAPG---------ST 791

  Fly   831 DWQSGMMRLQASPPEGLFYRNY 852
            |.....:||..|....:|..:|
Zfish   792 DLNYATLRLTVSTASAVFSGHY 813

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG43394NP_001245938.1 None
vwa10.1XP_021332508.1 Het-C <153..>172 CDD:311270
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.