DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG43394 and vwa10.2

Sequence 1:NP_001245938.1 Gene:CG43394 FlyBaseID:FBgn0263256 Length:948 Species:Drosophila melanogaster
Sequence 2:XP_685294.5 Gene:vwa10.2 ZFINID:ZDB-GENE-090313-295 Length:990 Species:Danio rerio

Alignment Length:787 Identity:150/788 (19%)
Similarity:251/788 (32%) Gaps:245/788 (31%)


  Fly   220 SEDDYYDEHA--EAKTTTTSTSTTQAPLPILRARFGGFPWATTQAPSPPTTSSTSSTTTTSTT-- 280
            ::||.|..|.  ..:....:...|...|..:|...|..|:......|..:..:....||.|.:  
Zfish   256 NKDDIYSSHGFLHPQAADLAIRATMDMLEDIRMAIGSKPFLQLMGISQTSVLAFVIDTTGSMSDD 320

  Fly   281 -TTTTTTSTTTTPSPRKQPKHIQVTGGLKPELLPADQLRNYIKDVYIRMPLAVIVDPSSASLEQA 344
             ....:.|.:...|.|..|:.            |::         ||.:|..   ||....|.:.
Zfish   321 IEAAKSVSFSIIDSRRGTPQE------------PSE---------YILVPFN---DPDFGPLTRT 361

  Fly   345 KRLYIDALQDKNIDI-KIVLVTLNAAGAPSAFSFNNTREFIAGLNSTKEHEGGNSF-----VGVL 403
                      .|.|| |..|.:|.|                         |||..|     .|:|
Zfish   362 ----------DNADIFKKRLTSLTA-------------------------EGGGDFPEMCLSGLL 391

  Fly   404 HAAELVPYDSAVFISTAVIPPHTEL--VQDAAITLLKKRIRLFL---LWYGER---SGSENETED 460
            .|....|..|.:|:.|......:||  :..|.|...|..:...|   ..|..|   |.|:..|..
Zfish   392 LALAGAPPSSDIFVFTDATAKDSELGSIVQAMIERTKSTVTFMLTGSFSYRRRRAVSQSQQFTSR 456

  Fly   461 AVG----GILGEVAIRSGGEIIHIVSTEHGQHIA------GNTLTLVADAYQG---SQELDLPVD 512
            ::.    .:..::|..|||:.|.:..:...|..|      .:.|..:....:.   ::...:.:|
Zfish   457 SLFQSDIQLYRDLAHVSGGQTIEVPKSTLSQATAVITDSSTSALVTILQVVRSPAIAENFSIVLD 521

  Fly   513 TTLSSLHVRIDANMRRATMETPNGEINLKKLAKFGGVNVTETLNNQELDAYVPLNKLRRASIFKL 577
            ::||::.|.|..:....|:.:|.            ||:.:.::.|..|.:.:.:..|:|     :
Zfish   522 SSLSNVTVYITGDSPFFTLYSPT------------GVSQSGSVANGLLGSILTVGNLKR-----I 569

  Fly   578 KLQPE-LHDKYNVFVRAERKADVFLGDIIKRIDSYYKTGQTKAKSAKLQFPDKEKDTEKLEEDVD 641
            ||..| ...::.:.:.|               .|:|                      .|:...:
Zfish   570 KLSSENQKGEWRISINA---------------TSFY----------------------SLKVTAE 597

  Fly   642 SPKNEIETFSEQEIQSS---PNLNQ-------TLLAPSTGQSRSTLNAMLL-------------- 682
            |..|.:..|.||. |||   |..|:       ||....||....|:..:||              
Zfish   598 SSVNFLFNFVEQS-QSSDFTPKANRPFIGRNATLFVSVTGGDSVTVTDVLLVEASGSAVVNGTIK 661

  Fly   683 ------------------------------------------QRCGTKIELGIESKLLVMAGQTA 705
                                                      |:.|:|:.:..:....:..|...
Zfish   662 AVGTTDFLVNIDTIPEWAFVVQLRGLFNDSLAVSRFQRQSPTQQQGSKLTIKAQPSSTIEPGIPL 726

  Fly   706 TLLFEVTNMKTETVYSTIQVTDERRFLVQLNPTRLSLRAQETATVRLTVLVPTGTAQGTTDRITF 770
            .|.|.:.|..|...| ||:...:|.|.|.. |..|.:.|:.:|...:|::.|:||..||...:|.
Zfish   727 DLNFTLVNTATGGNY-TIRARTDRNFNVSF-PNSLIIGAEGSAQGTVTLIAPSGTDSGTDVTLTI 789

  Fly   771 ---------TNYGRETSTLAVNLKVVTSIDAQDSTGPTLSWEFGSRCDYLTPESQ---NCGERFW 823
                     :||      ||:...|:..:  .|.:.|.        |..:..::.   .|....|
Zfish   790 EAEAPASGDSNY------LALRFTVMNKV--TDLSRPV--------CQIVRIKADCPIECSSALW 838

  Fly   824 TVDVTAQDWQ-SGMMRLQASPPEG-LFYRNYYTAGSTEPLKATYMASCCEPKVSLIAFDAAGNQR 886
            .:.....|.. :|:..:..:...| |......:...|.....:|.||||...|.|:|.|..||..
Zfish   839 ELSANLTDGNGTGIAGVSINSGNGSLSLSTVMSENGTNVTLVSYNASCCSQDVELVAVDKVGNVG 903

  Fly   887 SLTIDVR 893
            :....:|
Zfish   904 TCFASIR 910



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.