DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG43394 and CG7453

Sequence 1:NP_001245938.1 Gene:CG43394 FlyBaseID:FBgn0263256 Length:948 Species:Drosophila melanogaster
Sequence 2:NP_573355.1 Gene:CG7453 FlyBaseID:FBgn0030991 Length:304 Species:Drosophila melanogaster

Alignment Length:205 Identity:48/206 (23%)
Similarity:82/206 (40%) Gaps:42/206 (20%)


  Fly   115 VSKVDKPARDYYYEDAPEDEMVASTTAKVATTMIPEYVRQ-----AKAERFPQRDQEHTSTDYIE 174
            ||...|...:...:|||   :||:.|..:...:||....:     |.::..|.:|     ...::
  Fly    16 VSGQQKQTANSATKDAP---VVANATNVLQAKVIPGSKLESGSPGAASQLVPGKD-----AAVLQ 72

  Fly   175 EDATKSVDEEPPADQFYRVEQHEPIPQAQVQQLPSRDKPKPF--EYSSEDDYYDEHAEAKTTTTS 237
            :|  |::::...|:.           ..:.:.|.:.|...|.  ..:|:.....:.|:..|.|||
  Fly    73 QD--KNLNKTATAEN-----------AGKAKNLTNTDTGVPTIPLVTSKPAVEQKAAKEATNTTS 124

  Fly   238 TSTTQAPLPILRARFGGFPWATTQAPS-----PPTTSST---------SSTTTTSTTTTTTTTST 288
            |:|:........|:........|:..|     .|:.|||         |:.|.|:||.|..:|..
  Fly   125 TTTSSTTTTTTTAKPAAGSAIVTEGQSMKDVTKPSNSSTNGAAISPTNSTHTATATTKTVNSTII 189

  Fly   289 TTTPSPRKQP 298
            .|||.|:|.|
  Fly   190 ATTPKPKKPP 199



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR16021
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.