DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG43394 and RGD1311946

Sequence 1:NP_001245938.1 Gene:CG43394 FlyBaseID:FBgn0263256 Length:948 Species:Drosophila melanogaster
Sequence 2:NP_001020854.1 Gene:RGD1311946 RGDID:1311946 Length:477 Species:Rattus norvegicus

Alignment Length:212 Identity:53/213 (25%)
Similarity:69/213 (32%) Gaps:87/213 (41%)


  Fly   226 DEHAE----AKTTTTSTS-------------------TTQAPLPILRARFGGFPWATTQAP-SPP 266
            |.||.    ||:|.|:||                   ||..|:.....|....|..||..| :|.
  Rat   245 DPHARTLSPAKSTPTNTSSRNPIPTSGAQTQGTTIQVTTDQPVHSTAGRPTPSPSNTTLEPNTPK 309

  Fly   267 TTSSTSSTTTTSTTTTTTTTSTTTTP-------------SPRKQPKHI---QVTGGLKPELL--- 312
            :.:||||...|:|...|...|.:|.|             ||..||..:   |.|||  |.:|   
  Rat   310 SVASTSSAVVTTTQVQTKEPSASTVPVLPTSMSPEVEATSPTTQPSPLLPTQGTGG--PGILLTT 372

  Fly   313 ---------------PADQLRNYIKDVYIRMP-------------LAVIVDPSSASLEQAKRLYI 349
                           |..:....:|     :|             |.|..||.:.||.....|.:
  Rat   373 EQVGTKATAGTASAGPTSRSSGDVK-----VPTTASCQLSTQGQYLVVTTDPLTPSLVNKMFLLV 432

  Fly   350 DALQDKNIDIKIVLVTL 366
                     :.||.|||
  Rat   433 ---------VLIVGVTL 440

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG43394NP_001245938.1 None
RGD1311946NP_001020854.1 PHA03247 <12..367 CDD:223021 37/124 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR16021
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.