DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG43394 and Vwa7

Sequence 1:NP_001245938.1 Gene:CG43394 FlyBaseID:FBgn0263256 Length:948 Species:Drosophila melanogaster
Sequence 2:NP_613048.1 Gene:Vwa7 MGIID:1306798 Length:891 Species:Mus musculus

Alignment Length:640 Identity:127/641 (20%)
Similarity:219/641 (34%) Gaps:119/641 (19%)


  Fly   252 FGGFPWATTQAPSPPTTSSTSSTTTTSTTTTTTTTSTTTTPSPRKQPKH--------------IQ 302
            ||..|      |.||...|.......|::..........:.||...|.|              |:
Mouse   233 FGMHP------PKPPGKCSHGGHFDQSSSQPPRGGINKDSTSPSFSPHHKLHLQAAEVALLASIE 291

  Fly   303 VTGGLKPELLPADQLRNYIKDVYIRMPLAVIVDPS-------SASLEQAKRLYIDALQDKNID-I 359
            ....|:..|  .|:..:.:.|:.....|:.::|.:       :|:..||:|: ::..|...:: :
Mouse   292 AFSLLRSRL--GDKAFSRLLDITPASSLSFVLDTTGSMGEEINAAKIQARRI-VEQRQGSPMEPV 353

  Fly   360 KIVLVTLNAAGAPSAFSFNNTREFIAGLNSTKEHEGGNSFVGVLHAAEL----VPYDSAVFISTA 420
            ..:||..:..|....|:.::...|...||......||:.....|.|.||    .|..|.:|:.|.
Mouse   354 FYILVPFHDPGFGPVFTTSDPDSFWQKLNEIHALGGGDEPEMCLSALELALLHTPPLSDIFVFTD 418

  Fly   421 VIPPHTELVQDAAITLLKKRIRLFLLWYGE--RSGSENETEDAVGGILGE----VAIRSGGEIIH 479
            ..|....|.........::|.|:..|...:  |:|.....| |:..:..|    :|..||||:|.
Mouse   419 ASPKDALLTNRVESLTRERRCRVTFLVTEDPSRTGGRRRRE-ALSPLRFEPYEAIARASGGEVIF 482

  Fly   480 I-------VSTEHGQHIAG-NTLTLVADAYQGSQELDLPVDTTLSSLHVRIDANMRRATMETPNG 536
            .       |:...|:.:|| .||.|....:...:.....||:.|..:.||:..::....:::|.|
Mouse   483 TKDQYIQDVAAIVGESMAGLVTLPLDPPVFTPGEPCVFSVDSLLWQVTVRMHGDISSFWIKSPAG 547

  Fly   537 EI-----------NLKKLAKFGGVNVTETLNNQELDAYVPLNKLRRASIFKLKLQPELHDKYNVF 590
            ..           :.::..:|..|.:|:.......:..|......|.   :::.|..|...::..
Mouse   548 VSQGPEEGIGPLGHTRRFGQFWTVTMTDPPRTGTWEIQVAAAGTPRV---RVQAQTSLDFLFHFG 609

  Fly   591 VRAERKADVFLGDIIKRIDSYYK---------TGQTKAKSAKLQF--------PDKEKDTEKLEE 638
            :..|......|..:.:.:.....         |.:.|....:.||        |:..:......|
Mouse   610 ISVEDGPHPGLYPLTQPVAGLQTQLLVEVTGLTSRQKLVGGQPQFSHVVLRRVPEGTQLGRVSLE 674

  Fly   639 DVDSPKNEIETFSEQEIQSSPNLNQTLLAPST---------GQSRSTLNAMLLQRCGTK---IEL 691
            .|..|...:         .:.:|..|||:.|:         |....:|.....|.|...   :||
Mouse   675 PVGPPVRGL---------LAASLPPTLLSVSSPFSLELVGQGGGGESLRRTAPQPCSVAPVLLEL 730

  Fly   692 GIESKLLVMAGQTATLLFEVTNMKTETVYSTIQVTDER-----RFLVQLNPTRLSLRAQETATVR 751
            ......|. .|..|.|...:.:      :|..|..|.|     .|.:..|.:|..|...|:|..|
Mouse   731 SGPPDFLT-PGSKAPLSLHIVS------FSGPQDLDLRTSVNPSFSLTSNLSRARLGLNESAWGR 788

  Fly   752 LTVLVPTGTAQGTTDRITFTNYGRETSTLA-----VNLKVVTSIDAQDSTGPTLS 801
            |.:.||...|..:...:|.|..|:..|.:.     :.|.|:.........||..|
Mouse   789 LWLEVPDSAAPDSVVMVTVTAAGQGASQVPPTHAFLRLLVLAQSSKDQLDGPAHS 843

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG43394NP_001245938.1 None
Vwa7NP_613048.1 Het-C <164..>191 CDD:284602
YfbK 279..>521 CDD:225187 52/246 (21%)
VWA_2 319..497 CDD:290253 41/180 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.