DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG43394 and vwa7

Sequence 1:NP_001245938.1 Gene:CG43394 FlyBaseID:FBgn0263256 Length:948 Species:Drosophila melanogaster
Sequence 2:XP_003200526.2 Gene:vwa7 ZFINID:ZDB-GENE-060503-234 Length:1010 Species:Danio rerio

Alignment Length:1017 Identity:189/1018 (19%)
Similarity:333/1018 (33%) Gaps:295/1018 (29%)


  Fly    98 GENSSAEMIDDASTQKRVSKVDKPARDYYYEDAPED-------EMVASTTAKVATTMIPEY--VR 153
            ||.:||.:..|..:..|...|      |:::....|       |..|.|   :..|...||  .|
Zfish    86 GEVASANVAMDFLSSTRSDPV------YHFDSERVDGAIQMLREFWAQT---ILLTQAKEYQGAR 141

  Fly   154 QAKAERFPQRDQEHTSTDYIEEDATKSVDEEPPADQFYRVEQHEP-IPQAQVQQLPSRDKP---K 214
            ::..:.|......::.::::|......        ..:.:...|| :|.|      |.|.|   :
Zfish   142 RSLGQLFHSLQDFYSHSNWVEMGQQTL--------YLHLLHPEEPSVPVA------SADTPTCAE 192

  Fly   215 PFEYSSEDDYYDE--HAEAKTTTTSTSTTQAPLPILRARFGGFPWATTQAPSPPTTSSTSSTTTT 277
            .:.||..::...|  |......||...:|....|..:...||.               ..|:...
Zfish   193 CYRYSCYNNLLKEMIHQTKPLLTTGYFSTYPVKPPGKCSHGGI---------------LDSSRHQ 242

  Fly   278 STTTTTTTTSTTTTPSP----RKQPKHIQVTGGLK----------PELLPADQLRNYIKDVYIRM 328
            .........||:...||    .|:..|:..|..|:          ||        ::::...::.
Zfish   243 GAEGGINKDSTSPLFSPHHFLHKEAAHLASTATLRVLQDLRHRVGPE--------SFLRLFSVQQ 299

  Fly   329 P--LAVIVDPSSASLEQ--AKRLYIDAL-------QDKNIDIKIVLVTLNAAGAPSAFSFNNTRE 382
            |  |..::|.:.:..|:  |.||...::       :..::....|||..:..|.......::...
Zfish   300 PPALVFVMDTTGSMFEEITAARLRAFSIIQARGKSRRTSLPGTFVLVPFHDPGFGPVMETDDPDR 364

  Fly   383 FIAGLNSTKEHEGGNSFVGVLHAAELV----PYDSAVFISTAVIPPHTELVQDAAITLLKKRIRL 443
            |:..|.:.....||:.....|.|.:|.    |..|.:|:.|...|....|.......:|:|:.::
Zfish   365 FMQNLENLTALGGGDEPEMCLSALQLALTHSPPLSEIFVFTDASPKDRHLQSAVQALILEKQTKV 429

  Fly   444 -FLL---------WYGERSGSENET--------EDAVGGILGEVAIRSGGEIIHIVSTEHGQHIA 490
             |||         ..|.|.....||        ..::..:.|.:.|.:..:.||..|........
Zfish   430 NFLLTEDPNIGGGGKGMRKMKRRETLSPGRFSLYSSLSSLSGGMTIFTSNKDIHKASAIVEDTTT 494

  Fly   491 GNTLTLVADAYQGSQELDLPVDTTLSSLHVRIDANMRRATMETPNGEINLKKLAKFGGVNVTETL 555
            .:.:||.....:.:......||..::.:.:.|...:....:.:|:| ::.....|.|.:.|.:: 
Zfish   495 SSKVTLFHTNVESNSSNSFRVDRAVTKVMLHITGQLTDCELVSPSG-VHQSLFGKDGPLAVMDS- 557

  Fly   556 NNQELDAYVPLNKLRRASIFKLKLQPELH-DKYNVFVRAERKADV-FLGDIIKRIDSYYKTGQTK 618
                           ...::::.|.|.|. ..:.:.|:|...... .|||  ..:|..|..    
Zfish   558 ---------------SKGLYRISLLPPLDIGVWQLTVKAIGPITFNALGD--SSLDFLYYF---- 601

  Fly   619 AKSAKLQFPDKEKDTEKLEEDVDSPKNEIETFSEQEIQS-SPN-----LNQTLLAPSTGQS--RS 675
            |:.|....|    ...|:|   .||...|..|....:.. |||     .:.|||.|. |:|  :.
Zfish   602 AREANETHP----GLRKIE---GSPIAGIPAFLIVAVTGLSPNEEASFSHVTLLGPK-GESLQKV 658

  Fly   676 TLNAM---------------------------------LLQRCGTK------IELGIESKLLVMA 701
            .||:.                                 ||:|..|:      :::.:.|...::.
Zfish   659 LLNSSSSRWSGEELVGYMDSVPRMPFSLRLSGKDRKGNLLERVSTEMIQPTHVQIQVHSAPQLLP 723

  Fly   702 GQTATLLFEVTNMKTETVYSTIQVTDERRFLVQLNPTRLSLRAQETATVRLTVLVPTGTAQGTTD 766
            |.::.:|||:.|......:|.: ..|:..||...:..||.:..:.:....:.:..|..|..|...
Zfish   724 GHSSNVLFEIFNHGPNRHFSLL-AEDDHGFLTHQDQQRLFIGTRGSVKREVEIRTPHTTQTGKAI 787

  Fly   767 RITFT---------NYGRETSTLAVNLKVVTSIDAQDSTGPTLSWEFGSRCDYLTPES---QNCG 819
            .:|.|         ||.      .|:|.|:.  :..|...|.        |..|..||   ..|.
Zfish   788 TLTLTVQAEDSPDSNYA------VVHLTVIP--EKPDKNPPA--------CSSLHVESSCPSLCS 836

  Fly   820 ERFWTVDVTAQD-WQSGMMRLQASPPEG------------------------------------- 846
            :..|.|.:.|:| ..||:..::.:..||                                     
Zfish   837 QGNWKVSLLAKDRGHSGLASIELTQGEGRLILSEMTTQRHTEHFPKLHEESTGGVYLPLLQPQKN 901

  Fly   847 ----------------------LFYRNY------YTAGSTEPLKATYMASCCEPKVSLIAFDAAG 883
                                  |.|.::      :|.|  :|:...|.:|||.|...|:..|.||
Zfish   902 SSEINTHVGTEVHHGQRLEGVQLMYGDHPANISEWTKG--KPILMHYSSSCCAPHAELLLLDKAG 964

  Fly   884 N----------QRSLTIDVRDVYLNEAAIAAICLGVILLILL 915
            |          ||:|..:.|.......:...:.||.::||:|
Zfish   965 NMRRCHLKASQQRALRENNRAHSGESTSCLPMLLGHLVLIVL 1006

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG43394NP_001245938.1 None
vwa7XP_003200526.2 Het-C <140..>171 CDD:284602 3/39 (8%)
VWA_2 302..>438 CDD:290253 28/136 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.