DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bsg and dim-1

DIOPT Version :10

Sequence 1:NP_723346.2 Gene:Bsg / 318841 FlyBaseID:FBgn0261822 Length:648 Species:Drosophila melanogaster
Sequence 2:NP_001024420.1 Gene:dim-1 / 181062 WormBaseID:WBGene00001000 Length:640 Species:Caenorhabditis elegans


Alignment Length:232 Identity:46/232 - (19%)
Similarity:75/232 - (32%) Gaps:54/232 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   408 NAEHQMKFYDIRSP-LVLSCNVKDGTPGGVLIWKKNGTAVTDVPSL-------RGRFKLIADENK 464
            ||...:|.....|| .|....:.....|.|::.:....::.: |:.       .|..::||:.::
 Worm   409 NANFNLKLTGFSSPTFVEKPQISSRDDGQVMVMEFRAKSILE-PTFVWQKLVGGGAEEIIANSDR 472

  Fly   465 F-----------------IIDKTDTNDDGKYSCEFDGVSKEIEVIARVVVRVPSNT--------- 503
            .                 |.:.|...|.|::.|.....|.::.....|...||...         
 Worm   473 IKAVKKLEAGNVYYSALEIKEPTKDKDAGQFICTVKNESGKLTATFTVKFEVPEGAPSFTRKPQI 537

  Fly   504 ---AVVEGEKMSVTCSVVG----TKPELTWTFANVTLTNATDRFILKPDDNGVPN--AILTLDNV 559
               ....||  ...|..:|    ..|::||..........:.|...|.:|.|..|  |.|.|.|.
 Worm   538 LQQTSAGGE--PAICFDIGYSARMNPQVTWISPKSKKMKESSRIKFKTNDEGNGNFTAQLELTNY 600

  Fly   560 TLDDRGEYKCIGRNAANVYGGNTTTPASDVTTVRVKG 596
            ...|.|.|.|..:|.|.        .|:...|:.::|
 Worm   601 KAKDSGTYTCNIKNDAG--------EANVELTLNIEG 629

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BsgNP_723346.2 Ig 423..481 CDD:472250 11/81 (14%)
Ig strand B 423..426 CDD:409353 1/2 (50%)
Ig strand C 436..440 CDD:409353 1/3 (33%)
Ig strand E 463..467 CDD:409353 0/20 (0%)
Ig strand F 477..481 CDD:409353 0/3 (0%)
Ig_3 495..573 CDD:464046 23/95 (24%)
dim-1NP_001024420.1 Ig 323..415 CDD:472250 2/5 (40%)
Ig strand B 339..343 CDD:409353
Ig strand C 352..356 CDD:409353
Ig strand E 380..386 CDD:409353
Ig strand F 396..401 CDD:409353
Ig 422..521 CDD:472250 14/99 (14%)
Ig strand B 439..443 CDD:409473 0/3 (0%)
Ig strand C 452..456 CDD:409473 0/3 (0%)
Ig strand E 487..491 CDD:409473 0/3 (0%)
Ig strand F 502..507 CDD:409473 1/4 (25%)
Ig 529..627 CDD:472250 24/107 (22%)
Ig strand B 550..553 CDD:409405 1/2 (50%)
Ig strand C 562..567 CDD:409405 2/4 (50%)
Ig strand E 593..597 CDD:409405 2/3 (67%)
Ig strand F 607..612 CDD:409405 2/4 (50%)
Ig strand G 620..623 CDD:409405 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.