DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dpy and THBD

Sequence 1:NP_001260032.1 Gene:dpy FlyBaseID:FBgn0053196 Length:22949 Species:Drosophila melanogaster
Sequence 2:NP_000352.1 Gene:THBD HGNCID:11784 Length:575 Species:Homo sapiens

Alignment Length:620 Identity:156/621 (25%)
Similarity:197/621 (32%) Gaps:191/621 (31%)


  Fly   179 ARCVENAECCNL---PAHFL-----CKCKDGYEGDGEVLCTDVDECRNPENCGPNALCTNTPGNY 235
            ::|||: :|..|   ||.||     |   ||..|.   |.|    .|:.......:|..|     
Human    28 SQCVEH-DCFALYPGPATFLNASQIC---DGLRGH---LMT----VRSSVAADVISLLLN----- 76

  Fly   236 TCSCPDGYVGNNPYREGCQDVDECSYPNVCGP--------GAICTNLEGSYRCD------CPPGY 286
                .||.||......|.|....|..|...||        |...|:.....|.|      |.|..
Human    77 ----GDGGVGRRRLWIGLQLPPGCGDPKRLGPLRGFQWVTGDNNTSYSRWARLDLNGAPLCGPLC 137

  Fly   287 DGDGRSESGCVDQDECARTPCGRNADCLNTDGSFRCLC------PDGYS-------GDPMNGCED 338
            .....:|:....:.......|...||....:..|...|      |...:       |.|. ....
Human   138 VAVSAAEATVPSEPIWEEQQCEVKADGFLCEFHFPATCRPLAVEPGAAAAAVSITYGTPF-AARG 201

  Fly   339 VDECATNNPCGLGAECVNLGGSFQCRCPSGFVLEHDPHADQLPQPLNTQQLGYGPGATDIAPYQR 403
            .|..|.  |.|..|....||....|..|.|.|..|....              .|||.|      
Human   202 ADFQAL--PVGSSAAVAPLGLQLMCTAPPGAVQGHWARE--------------APGAWD------ 244

  Fly   404 TSGAGLACLDIDECNQPDGVAKCGTNAKCINFPGSYRCLCPSG--FQGQG-------YLHCENIN 459
                         |:..:|    |....|...||:.||.||:|  .|..|       ...|.::.
Human   245 -------------CSVENG----GCEHACNAIPGAPRCQCPAGAALQADGRSCTASATQSCNDLC 292

  Fly   460 E--CQDNPCGENAICTDTVGSFVCTCKPDY--TGDPFRGCVDIDECTALDKPCGQHAVCENTVPG 520
            |  |..||        |..||:.|.|:..|  ..|..| |.|:|:|.....||.|.  |.||..|
Human   293 EHFCVPNP--------DQPGSYSCMCETGYRLAADQHR-CEDVDDCILEPSPCPQR--CVNTQGG 346

  Fly   521 YNCKCPQGYDGKPDPKVACEQVDVNILCSSNFDCTNNAECIENQCFCLDGFEPIGSSCVDIDEC- 584
            :.|.|...||          .||              .||:|                 .:|.| 
Human   347 FECHCYPNYD----------LVD--------------GECVE-----------------PVDPCF 370

  Fly   585 RTHAEV-CGPHAQCLNTPGSYGCECEAGYVGSP--PRMACKQPCEDVRCGAHAYCKPDQNEAYCV 646
            |.:.|. |.|..|.     ||.|.|..|:...|  |. .|:..|....|.|.  |.|: .:|.|.
Human   371 RANCEYQCQPLNQT-----SYLCVCAEGFAPIPHEPH-RCQMFCNQTACPAD--CDPN-TQASCE 426

  Fly   647 CEDGWTYNPSDVAAGCVDIDECDVMHGPFGSCGQNATCTNSAGGFTCACPPGFSGDPHSKCVDVD 711
            |.:|:..:...:   |.|||||:  :|.|.|    ..|.|..|.|.|.|.|..:...|.. .|.|
Human   427 CPEGYILDDGFI---CTDIDECE--NGGFCS----GVCHNLPGTFECICGPDSALARHIG-TDCD 481

  Fly   712 ECRTGASKCGAGAECVNVPGGGYTCRCPGNTIADP 746
            ..:......|:|.     |....|   ||:|:..|
Human   482 SGKVDGGDSGSGE-----PPPSPT---PGSTLTPP 508

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dpyNP_001260032.1 EGF_3 137..166 CDD:289699
EGF_CA 212..247 CDD:238011 7/35 (20%)
EGF_CA 255..>286 CDD:214542 10/45 (22%)
EGF_CA 298..331 CDD:238011 7/46 (15%)
EGF_CA 338..373 CDD:238011 11/35 (31%)
EGF_CA 413..456 CDD:238011 14/52 (27%)
EGF_CA 457..490 CDD:238011 10/37 (27%)
EGF_CA 497..>529 CDD:214542 12/32 (38%)
EGF_CA 580..>612 CDD:214542 12/34 (35%)
EGF_3 676..702 CDD:289699 8/26 (31%)
EGF_CA 1022..1056 CDD:214542
EGF_CA 2227..2260 CDD:238011
EGF_CA 2393..>2422 CDD:214542
DUF4758 4088..4282 CDD:292572
DUF4696 4127..4678 CDD:292395
DUF4758 4275..4448 CDD:292572
DUF4758 4377..4574 CDD:292572
DUF4758 4581..4754 CDD:292572
DUF4758 4683..4847 CDD:292572
DUF4758 4785..4964 CDD:292572
DUF4696 4841..5385 CDD:292395
DUF4758 4887..5098 CDD:292572
DUF4758 5193..5371 CDD:292572
DUF4758 5294..5487 CDD:292572
DUF4758 5445..5650 CDD:292572
DUF4758 5700..5877 CDD:292572
DUF4696 5756..6396 CDD:292395
DUF4758 5802..5979 CDD:292572
DUF4758 5964..6171 CDD:292572
DUF4758 6181..6360 CDD:292572
DUF4696 6339..6999 CDD:292395
DUF4758 6662..6839 CDD:292572
DUF4758 6764..6941 CDD:292572
DUF4758 6866..7045 CDD:292572
DUF4758 6968..7179 CDD:292572
DUF4696 7024..7569 CDD:292395
DUF4758 7172..7383 CDD:292572
DUF4696 7330..7964 CDD:292395
DUF4758 7400..7587 CDD:292572
DUF4758 7538..7707 CDD:292572
DUF4758 7798..7979 CDD:292572
DUF4758 7946..8126 CDD:292572
YppG 18767..>18832 CDD:290883
Med25_SD1 18795..18955 CDD:288132
MISS 19026..19258 CDD:292450
ZP 22576..22811 CDD:214579
Zona_pellucida <22714..22810 CDD:278526
THBDNP_000352.1 CLECT_thrombomodulin_like 30..171 CDD:153070 38/161 (24%)
FXa_inhibition 245..280 CDD:291342 13/39 (33%)
FXa_inhibition 289..323 CDD:291342 12/43 (28%)
EGF_CA 325..>355 CDD:214542 12/32 (38%)
Tme5_EGF_like 406..439 CDD:286192 9/39 (23%)
EGF_CA 441..>468 CDD:214542 14/33 (42%)
Involved in alpha-L/beta-2 and alpha-M/beta-2 integrin binding. {ECO:0000269|PubMed:27055590} 481..515 9/37 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1174178at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.