DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dpy and scospondin

Sequence 1:NP_001260032.1 Gene:dpy FlyBaseID:FBgn0053196 Length:22949 Species:Drosophila melanogaster
Sequence 2:XP_021325919.1 Gene:scospondin ZFINID:ZDB-GENE-051114-1 Length:5530 Species:Danio rerio

Alignment Length:7212 Identity:1457/7213 (20%)
Similarity:2028/7213 (28%) Gaps:2959/7213 (41%)


  Fly  9017 QGAHCQVE----EHHPVCSCNSGLTGNPGI-RCYALDHPKKNPCVPSPCGRNSECKLLNNRAVCS 9076
            ||....||    ||          .|:.|| |.|....||....:..|....:|   :.||.|..
Zfish    52 QGWRLDVERMRHEH----------GGDDGIARYYQRQGPKAACYIFKPPDIETE---VVNRTVRQ 103

  Fly  9077 CIPGYLGDPQSGCQPEC----DINSDCGDTLSC--------INHKCVDPCAGAICGINAICNVRQ 9129
            |..|:.|       |.|    .:...|..|.:|        .:...::.|.|.:..: :..|...
Zfish   104 CCEGWTG-------PHCTQGVSVRGQCFSTWTCEEFPGVQNSSLMALEQCCGHLWAL-SWRNASD 160

  Fly  9130 HTPVCL-CLDGFVGDAFLQCVPI---GILKNVSRDPCAPSPC----GPH---------------- 9170
            ||  || |....:.|  :...|:   |:|:.| |||.|.|.|    |.|                
Zfish   161 HT--CLSCTYTLLPD--VGSSPVVRGGLLRGV-RDPQASSTCMSWSGTHFRTFDRKHFHFQGSCT 220

  Fly  9171 ----------------DVCSVYG------------------------DGVAL--CDPCFGPNAQQ 9193
                            .||...|                        :|:|:  .:|.|     |
Zfish   221 YLLASSTDGTWAVYISTVCETSGRCRKDLRMMLGLGLVSIHKDNMTVNGLAVPQGEPLF-----Q 280

  Fly  9194 NPRCRPECVGNS-----DCPFDRACLGQRCLDPCPGS----------CGRNAICNVYEHNPVCAC 9243
            |        |.|     |..|..:.||.|.......:          .....:|.||.:||....
Zfish   281 N--------GVSVHWLGDFVFVESGLGVRLKFDMENTIYLTVTAEHLTNTRGLCGVYNNNPDDDF 337

  Fly  9244 PTGL---------FGNPY------------------EQCTTKSVV--------------ETP--- 9264
            .|..         |||.:                  ..|...:.|              |||   
Zfish   338 TTSTGSVSQYAASFGNSWRVQDQQQSQVCSDAAELGHSCDLSNDVSLRRDAESACHLLKETPFSH 402

  Fly  9265 ------PQP---SCAKLHCGANA----------------ECKRQHSGLA------C--VCRKG-Y 9295
                  |.|   :|..|.|....                ||.:||..::      |  ||.:| .
Zfish   403 CHHQVDPGPYIDTCLYLFCSLEVKDRDTAVCDTLASYVRECAQQHIIISWRRRGFCERVCPRGQV 467

  Fly  9296 FGDPHIGCRPECVLNSDCPAEKACLN------SKCVEACTGVCGVNAVC--RVVNHAPVCI---- 9348
            |.|        ||  |.|||  .|.:      .:|.:.|.|.|    .|  .|..||..|:    
Zfish   468 FSD--------CV--SSCPA--TCASPRPPAAGQCRDECVGGC----ECPQGVYLHAGQCVRRDD 516

  Fly  9349 --C---AEGYSGDASIACNPFYLPPPERPHPCEPSPCGPNSRCKATPDGYAACSCLPNFKGAPPV 9408
              |   ...||...:|                       ..||.         :|         |
Zfish   517 CPCFHRRHSYSAGQTI-----------------------RQRCN---------TC---------V 540

  Fly  9409 CQPECVVSSECAPNQACLNQRCTDPCPGICGGGARCEVLNHNPICSCEANFEG-----DPFVACS 9468
            |:         |....|..::|.          |:|.||....|.:.:....|     ..|.|..
Zfish   541 CR---------AGQWECSTEKCE----------AQCSVLGAMHITTFDQKRYGLQTADCRFTAVE 586

  Fly  9469 PIQDPGRDIPVPKNPCVPSPCGPNSICQIKQNRPVCSCVANYIGSPPYCRPECTLS------SEC 9527
            ...|....|.:...||.....|                          |..|.:::      :..
Zfish   587 DFVDKKLSIIIGAGPCAGGEAG--------------------------CLREMSITALHTTLTVT 625

  Fly  9528 PSDKACINEKCQNPCANVCG----HNARCTVI---AHSAHCSCDEDYEGDAFIGCSKKITERPG- 9584
            .:....:|.. :||...|.|    ..|..:|:   |..|......|       |....||.:|| 
Zfish   626 DAGSVLVNGH-RNPLPVVTGDLLVRRASSSVLLIQAFGAQLMWHLD-------GPLLFITLQPGF 682

  Fly  9585 --------------DHIDPCYPNPCAENAVCTPYNNAARCTCIEPYNGDPYSTGCRPECIYSSEC 9635
                          .|.|...|....||:..   :.||:           :..|..|       .
Zfish   683 AHKVRGLCGTLSWSQHDDFTTPEGDVENSAA---SFAAK-----------FIVGSCP-------A 726

  Fly  9636 PSSLACIKQHCRDPCTAACG----ANAECTVVNHLPSCSCTRGFEGNPFDGCKRVVVVRP----- 9691
            ||::.      .|||.....    |...|:|::            .|.|..|..||...|     
Zfish   727 PSAMT------SDPCGTLTQRRQLAERVCSVIH------------SNVFQACHDVVDREPFMRLC 773

  Fly  9692 -ETVCEPNPCGPNSICRSVEGHPTCSCQVGYFGAPPQCRPECVVSSECAQ---------HLSC-- 9744
             ..||.   |||.:.|.       ||....|             ::.|||         |..|  
Zfish   774 VSEVCS---CGPQASCH-------CSVLTAY-------------ATHCAQEGALLSWRNHTFCPV 815

  Fly  9745 ------INQKCMDPCVGTC-----GFNAKCQVNNHNPI----CSCPANYEGNPFEQCMPKPAEPT 9794
                  :.|:|...|..:|     |::  |:.:..:.:    |.||.....:...||:|....|.
Zfish   816 QCSGGQVYQECGRLCGTSCADLWDGWS--CEPDEGSRVCVSGCQCPDGLAQDAQGQCVPVHMCPC 878

  Fly  9795 RNVDPCLPSPCGSNSICRNVNNRAECSCAPGMFGAPPNCRPECVINQDCP-----SNRACIRQRC 9854
            ::.|..  .|.|| ||..|.|.   |.||.|::.......||  :|| ||     |.|:|:|   
Zfish   879 KSGDTL--HPAGS-SINNNCNT---CVCARGVWNCTDLSCPE--LNQ-CPGSLIFSPRSCLR--- 931

  Fly  9855 EDPCIGICGFNAVCSTQNHQPKCSCIESFEGDPYTACKMREIVVL------DPPTDPCY------ 9907
                        .||:.| .|..:|.|...|     |...|..||      .|...||:      
Zfish   932 ------------TCSSPN-SPLDACTEPIHG-----CICPEGTVLLGDQCVKPDECPCHHNGRLY 978

  Fly  9908 ------PSPCGANAICRVRN---GAGSCS--CIQNYFGDP-YI-----------NCRPECVQNSD 9949
                  ...|. ..:||.:.   |...||  |:..  ||| ||           :|....||.|.
Zfish   979 FTNDTISKDCN-TCVCREQRWHCGQALCSGTCVAT--GDPHYITFDGRHYSFLGDCEYVLVQESS 1040

  Fly  9950 CPNNRACINMKCRDPCANACGFNAICRVAHHQPVCSCEPHLT-GNP----LRACVERPSNMYLPL 10009
            ...:.:..|:        .||...:        .|:....|| ||.    ||......:.:.:.|
Zfish  1041 GLFSVSAENV--------PCGSTGV--------TCTKSVTLTIGNTAIHLLRGKAVTVNGIPVTL 1089

  Fly 10010 PKDPCRP----SPCGLFSTC----------------------HVVG------------------- 10029
            ||.....    ...|||.:.                      |:.|                   
Zfish  1090 PKSYSGSGLILERVGLFVSLSSRLGVTLLWDGGMRVYVRLMPHLHGRVGGLCGNFDGDAENDFTT 1154

  Fly 10030 ERPVCACLPDYMGAPPNCKPECMTSAECPSDRACINQRCKDPC---PGTCGY-NARCRCTNHSPI 10090
            .:.:....|:..|......|.|...|:         |..:|||   |....: ..:|...|....
Zfish  1155 RQGIMESTPELFGNSWKISPSCPDVAD---------QDLRDPCFINPHRVTWAKKKCAVINQEIF 1210

  Fly 10091 CSCYDGYTGDPFHQCVPERKPPPIADPIVPPNPCVPSPCGPNSQCQVSSSGAVCSCVTNYIGRPP 10155
            .||:...   |:.|..               :.||...||    |   .||..|.|:        
Zfish  1211 SSCHSEV---PYQQYY---------------DWCVFDACG----C---DSGGDCECL-------- 1242

  Fly 10156 GCRPECSINSECPARMACINARCADPCIGSCGNNALCHVSLHAPVCMCEPGYSGDPFSGCYKIIE 10220
             |....:...||..|...:..|..:.|...| .|.|.:.:..|   .|.|.              
Zfish  1243 -CTAVAAYAEECNRRGVYVRWRSQELCPLQC-ENGLVYEACGA---ACSPA-------------- 1288

  Fly 10221 TPIEVIQPCRPSPCGLNALCEERNQAAACKCLPEYFGDPYVECRPECVINSDCPRSRACVNQKCV 10285
                    |..:|...::||...:....|.| |:  |..|.:  ..|:..|.||    |.....|
Zfish  1289 --------CPSTPSLSDSLCSALSCVEGCFC-PQ--GTVYHD--DACISPSQCP----CEWDGSV 1336

  Fly 10286 DPCPGMCGHNALCAVFNHAPNCECLPGYTGNPIVGCHIVPESPRYPDPIVPE------NPCQPSP 10344
            .|...|        |..|..|......:....|..|      .|:...:...      |....|.
Zfish  1337 FPAGAM--------VTQHCQNWSVYSLFIILNITHC------TRFSSEVFTALLHYGLNVSIRSS 1387

  Fly 10345 C--GLYSNCRPVNGHAVCSCVPSYIGSPPNCRP---ECMSSSE--------CAQDKSCLNERCKD 10396
            |  ||:            .||.|....|..|:.   .|...||        |..:..| .:...:
Zfish  1388 CSAGLW------------QCVGSPCPPPSPCKDSEFRCSGGSERCIPAVWVCDNEDDC-GDGSDE 1439

  Fly 10397 PCPGTCGNNALCRVVNHNPICSCSPGFSGDPFVRCFPQEKRPPITHDRIDPCVPSPCGPNSECRV 10461
            .||.||.....          .||.|       .|.|.|.|               |..:.:|  
Zfish  1440 VCPITCPPEHF----------RCSGG-------ACLPVELR---------------CDGHPDC-- 1470

  Fly 10462 SAANEQAVCSCLQHYVGRAPNCRPECTSDSECP-GNLACINLRCRDPCVGTCGIQTTCLVNNHRP 10525
            :..:::..|              |..|.:|.|| |...|.|.||               |..|: 
Zfish  1471 ADQSDEDFC--------------PPSTPESGCPSGEFRCANGRC---------------VPGHK- 1505

  Fly 10526 ICRCIDGYAGDPFSECSPKINVPVQVAQPCNPSPCGANAVCKE---RNGVGSCSCLPEYNGDPYT 10587
            :|   ||.....|::.|.:.:             ||  .||::   |...|.| .|..:..|.:.
Zfish  1506 VC---DGRMDCGFADDSDEYD-------------CG--VVCRQEEFRCSSGRC-VLFLHRCDGHD 1551

  Fly 10588 ECRPECVLNSDCSKNRACLNNKCRDPCPGVCGVSAE--CHVINHAPSCSCPSGFTGNPSQFCREI 10650
            :|       .|.|..|.|:.......|||...||||  |.     .:..||||           |
Zfish  1552 DC-------GDYSDERGCVCALGELQCPGDQCVSAERVCD-----GNRDCPSG-----------I 1593

  Fly 10651 PRLPAPVEPCRPSPCGPYS-QCREVNGHAVCSCVTNYIGTPPACRPECSVSSECAQDRACVNQRC 10714
            ..|..|.:.|.....|..| ||                 .|.|.|  |...::|..  ....:||
Zfish  1594 DELICPAKGCSQFEFGCTSGQC-----------------VPLAWR--CDGETDCLD--GSDEKRC 1637

  Fly 10715 ADPCPGTCGNEAICKVTNHNPICSCPAGYSGDPFVRCAPWQEEPEQPKSNENPCVPSPCGRNSQC 10779
            :..|.   .::.:|:              |||   :|..:|:               .|.....|
Zfish  1638 SRTCQ---SDQFLCQ--------------SGD---QCVQYQQ---------------LCDGTPNC 1667

  Fly 10780 RVVGETGVCSCLPNFVGRAPNCRPECTINTECPANLACINERCQDPCPGSCGFNAFCSVVNHSPI 10844
            |...:..:.:|...   |.|          .||.:.:|.|..|                ||.|.:
Zfish  1668 RDASDESLDNCGST---RIP----------PCPGSFSCDNRTC----------------VNASRV 1703

  Fly 10845 CT----CDSGYTGDPFAGCNPQPPAIPD-----ERLTP---CQPSPCGP-NAECRERNGAGSC-- 10894
            |.    |..|  .|.......:|.|.|.     .|:.|   |....|.| |..|   ||...|  
Zfish  1704 CNGIPDCPKG--EDEILCDKVRPSAAPPSEGNISRICPEFTCADGSCVPFNTMC---NGVSDCPG 1763

  Fly 10895 TCLPEYFG-------DPYSGCRPECVVNSDCSRDKSCVNQKCVDPCPGVCGLNAQCRVSNHLPSC 10952
            |...:..|       .|:|.|...| .:...||.:||        .||:.......:......|.
Zfish  1764 TEASDESGCGVWGPWGPWSACSRSC-GSGIMSRQRSC--------SPGLSDCRGHKKQRQQCYST 1819

  Fly 10953 SC-LAGY------TGNPSSACREIPQLPPPPERDENPCRPSPCGPYSQCREVDGHAVCSCLQGFI 11010
            :| :.||      ..|.|.:|..:       |..:..|.|...|..|          |:.|.|..
Zfish  1820 ACAVDGYWSPWSTWSNCSKSCGGV-------EIRQRECFPPQNGGRS----------CADLPGET 1867

  Fly 11011 GSAPNCRPECIISSDCAQNLNCQNQKC--------VDPCP---------GTCGIEARCQVINHYP 11058
            ....:.||       |||  :|.:..|        ...||         .||..:::|     :.
Zfish  1868 NMTTDIRP-------CAQ--DCSDVSCPAGLVSHTCASCPLTCAHVSGTATCDPDSKC-----FA 1918

  Fly 11059 ACSCAPGFTGDPFNRCTKILLEPPPTEKSGNPCIPSPCGPNSKCLDVR---------GSPACSCL 11114
            .|.|..|...:..::|.      ||.|     |:....|       ||         |...|.| 
Zfish  1919 GCWCPEGKVMNADHQCV------PPEE-----CVCEVSG-------VRYWPGQQVKVGCDICVC- 1964

  Fly 11115 PDYLGRPPNCRPECLSSADCPANLACVNQRCSNPCIGACGLHSVCTVIKHRPACECVPGYTGDPF 11179
              ..||..:|:|    :.:|..:....:......|:|.||:.||                     
Zfish  1965 --ERGRTQHCQP----NPECSVHCGWSSWSLWGECLGPCGVQSV--------------------- 2002

  Fly 11180 SGCAIVQQIAPPDETRNPCNPSPCGANAICRERNGAGSCACLPEYFGDPYSGCRPECVQNDDCDR 11244
                       ....|:|.||:..|....||                ..|...|           
Zfish  2003 -----------QWSFRSPNNPTKHGNGRQCR----------------GIYRKAR----------- 2029

  Fly 11245 SRACINNKCQ-DPCPGACGINAECRVLNH----GPNCNCFDGYTGDPHRSCSLIEVVTIRPEPCK 11304
                   :|| :||       :||..|.|    |      :.:.|...:.|..:..:|::     
Zfish  2030 -------RCQTEPC-------SECEYLGHTYAVG------ERWKGGQCQLCQCLPNLTVQ----- 2069

  Fly 11305 PSPCGPYSQCLDTNSHAVCSCLEGYIGAPPSCKPECVVSSECPQNRACINQKCEDPCRGSCGNNA 11369
               ||||  |    .:|...|.:|:|..|..       ..||                       
Zfish  2070 ---CGPY--C----PYAATGCPQGHILTPAE-------GDEC----------------------- 2095

  Fly 11370 KCQVVNHNPICTCQPGMTGDPISGCEPM-------PEVKNVENPCVPS-PCGPNSVC-RQIGNQA 11425
                      |.|:....|..|:...||       |.......|.||: |..|...| ..:|.|:
Zfish  2096 ----------CHCEERRNGSTITTTTPMILPITLEPSRPPEGPPTVPTYPLPPGDECWSALGVQS 2150

  Fly 11426 ----ACSCNAGYIGRPPTCRPECTNNDECQNHLSCQQERCVDPCPGSCGSNAICQVVQHNAVCSC 11486
                :.|.::...|.||                |..:....||               |..:   
Zfish  2151 LPAVSFSSSSHQAGHPP----------------SAGRLNTGDP---------------HRDL--- 2181

  Fly 11487 ADGYEGEPLFGCQLIPAVTP--TESPSSPCEPSPCGPHAE---CRERNGAGAC------------ 11534
             .|:..||....:| |..||  |..||.       ||:.:   ..:.|..|..            
Zfish  2182 -QGWSPEPEQYKEL-PHGTPEDTRHPSH-------GPYLQIDLLTQHNITGVLTQGGGVFDTFVS 2237

  Fly 11535 -----YCHDGFEGNPY-----DAQRGCRRECENNDDCTAVQA------CSRFKCVDPCNNICGDY 11583
                 :..||.:.:.|     ||:...:....|:||.....|      .:||..:.|.:...|.|
Zfish  2238 SFYLQFSSDGLQWSTYKEMITDARPKAKVFQGNSDDRGVSLARLDRMVSARFIRILPHDFQNGIY 2302

  Fly 11584 AICTV----DKHVPTCDCPPGYTGDPFFSCKPVPVTPRPPLNP---------CNPSPCGPNS--- 11632
            ....:    |...|...||||:     |.|      |.||  |         |:..|..|:.   
Zfish  2303 LRVEIMGCPDGTGPGAVCPPGH-----FLC------PAPP--PGLCIEEKLLCDGVPHCPDGADE 2354

  Fly 11633 -NCRAMNNQAVCSCQAGFINQPPNCK--PECVVSAECAPEKACVHKKCVDPCQHTCGIR------ 11688
             :|:..|...:....|. :..|...:  |..:.:.|..|.:..|       |....|:.      
Zfish  2355 RDCKHTNISHITPTAAA-LRTPSKIRTTPTLLTTTEGGPSQKGV-------CASALGLEDGRVHY 2411

  Fly 11689 ---AICTTKNHSP-----ICTCPRTMTGDP----------------FVECTRVA----------- 11718
               ...:.:.::|     :...|..|..:|                |:|.|.|:           
Zfish  2412 GQLTSSSYRENNPADAGRLNVVPNVMVMEPGWSPLPADPHPYFQVDFLEPTWVSGVVTQGSERMW 2476

  Fly 11719 -------------------ITNDNTTPSPAPASCVPSPCGPNA-KCQIVGNSPACSCLPNFIGA- 11762
                               .|....|.:|           |.. :.::|..:|....||..:.| 
Zfish  2477 GYLTKYRLAFALVENQFINFTESGDTDAP-----------PKMFEVRMVSRTPVTRWLPRLVRAR 2530

  Fly 11763 -----PPRCRPECVLNSECGPTEACINQKC------------------------ADPC------- 11791
                 |...|....|..|   ...|...:|                        .:|.       
Zfish  2531 FLRIIPVEFRHTFYLRVE---VLGCRGGRCVVWLVTPSSLVTTVPPGVPGVQNYTEPAGRPGYHN 2592

  Fly 11792 --SGSCGFEAK-----------------CHVL--------------NHLPICNCIEGYEGDPFVR 11823
              ||:.|.:.|                 .|::              :.||...|:||........
Zfish  2593 YTSGAPGLQTKSPQDGRPGVATPTGGPDLHIITPTATAFWDASTPYDELPRVECVEGQFSCRTFG 2657

  Fly 11824 CTKKE------ED------------RSPPP----PND-PCNPNPCGQNA-DCFAGECRCQNNYQG 11864
            |.:.|      ||            .||||    |:. |..|..|.... .|::|||...:.   
Zfish  2658 CVEDELVCDGHEDCPDGSDELHCGSASPPPGRVSPSQRPLLPKLCSSKQWSCWSGECVSLDR--- 2719

  Fly 11865 NAYEGCRPECTLSADCPRDKACMRNRCVD----------PCPGICGNNAVCEVMNHIPVCSCVKG 11919
                    .|.|.:||.  .....|.|.|          .|...||..::               
Zfish  2720 --------RCDLHSDCA--DGSDENDCYDCILSSWASWSQCSVSCGLGSI--------------- 2759

  Fly 11920 YEGDPFVNCRVKPVVEDPIIEACSPSPCGSNSQCRDVNGHAVCSCLEGYIGAPPQCRP----ECV 11980
                    .|.|.::.|    |.....||                     ||....||    .|.
Zfish  2760 --------FRQKNILRD----ARPGGSCG---------------------GAQFDSRPCFLQACP 2791

  Fly 11981 VSSECSALQACVNKKCVDPCAAACGLEARCEVINHSPICGCPPGRTGDPFKQCVVLPPIAVPDVK 12045
            ||.:.|.....  ..|..|||.  ||..|      :..|..||.:.|.  :.|         :..
Zfish  2792 VSGQWSEWTQW--SGCDVPCAG--GLMVR------NRTCSNPPPKNGG--RDC---------EGM 2835

  Fly 12046 SPPQDPCVPSPCGPNSICKNDRNGPVCQCQPEFFGSPPNCRPECIINPDCQSTQACINNKCSNPC 12110
            |.....|....||.::   :.::|               |....|:..:..    |:..|.| ||
Zfish  2836 SRQTHTCNTQSCGSDT---DTQSG---------------CTGGMILMDESD----CLAGKFS-PC 2877

  Fly 12111 PESCG---TNAECRVIGHAVSCSCPTGYAGNAFVQ---CVPQQE----------EPPKPCQPSPC 12159
            |.:|.   :...| .:.....|.||.|    .|:|   ||...|          :|.:....|.|
Zfish  2878 PLTCSDLHSERNC-TLNCTAGCHCPPG----LFLQSGRCVNVSECECFWNGSLIQPGQDVSNSSC 2937

  Fly 12160 GPNAECIERNGAAACKCIDEYQGNPYEGCRPEC---VLSSDCPTDKTC---IRNKCQDPCPGICG 12218
               :.|:.::|...|   ||      ..|...|   ..||....|.:|   ::::.:.|...:..
Zfish  2938 ---SSCVCKDGRVLC---DE------SSCVARCDWSAWSSWTSCDSSCGTGVQHRYRSPLSAVGA 2990

  Fly 12219 LNAQCYAVNHVPNC------------VCNDGYTGDPFASCRRVEVTTPSPVSDPCI--PSPCGAN 12269
            |        ||..|            .|.||..|..::     :.|..|..|..|.  ....|..
Zfish  2991 L--------HVEPCEGDSTEARRCSVPCTDGADGAQWS-----DWTHWSECSKTCFHHVDAVGMR 3042

  Fly 12270 SKCRVANGLAVCSCMETFIGAPPNCKPECTVNAECPSNRACHKFRCANPCAKTCGLNAKCEVINH 12334
            .:.|..|....|:      |.....:|..|::  ||.|.....:...:.|:..|....:      
Zfish  3043 KRFRSCNHTHTCA------GDADEQEPCNTLH--CPVNGGWSSWSSWSDCSSDCDSGVQ------ 3093

  Fly 12335 NPICSCPLDMTGDPFARCYPAPPPPP-------PGPKDEPVRRPCQPSPC------GL----NSE 12382
                      |.:.|...     |||       |||..:  .|.|...||      |:    ..:
Zfish  3094 ----------TSERFCSF-----PPPLYGGLVCPGPHMQ--TRDCNVQPCTGVCPDGMTFLWKHQ 3141

  Fly 12383 CRVRDEQASCSCLPNFIGAPPNCRPECVVNTDCSP-----DQACI-AEKCRDPC--DGSCGVDSE 12439
            |..:.......||...  |...|..||.....|||     :::|: .:.|  ||  .|:..:..:
Zfish  3142 CEAQGGACPRVCLDAM--ADVQCASECYDGCYCSPGFYLFNKSCVHLQFC--PCVHQGALLMPGD 3202

  Fly 12440 CRVQNHLAICTCRGGFTGDPFVRCFEFVEETTKSPPLTQDPCDLQPCGSNAECRNGICSCLADYQ 12504
            ...::....|||..|     .::|.|             :||.:. ||.:.......||...|  
Zfish  3203 SVPRDSCNNCTCVNG-----EMQCGE-------------EPCPVH-CGWSEWTSWSACSRTCD-- 3246

  Fly 12505 GDPYTGCRPECTLSTDCAPT---KAC------LNKKCVDPCPGVCG---QNSQCDVSNHIPICSC 12557
                .|.|......|:.||.   :.|      |:...|.||.||.|   :.|:|.|       ||
Zfish  3247 ----VGIRRRYRSGTNPAPAFGGRVCEGERIGLDTCSVTPCFGVKGPWSRWSECSV-------SC 3300

  Fly 12558 LQGY---TGDPFVHCRHETPVAKDPCQPNPCGPNSLCHISGQGPVCA------------------ 12601
            ..||   |..|.  ..|.|......|...|||..|.|....|..||.                  
Zfish  3301 GGGYRSRTRGPI--RSHGTQQQFSACNLQPCGNRSGCSGGQQWSVCVREQLLCSDLGTEAQKDAH 3363

  Fly 12602 CQPGMLGSPPACK---------PECIVSSECSLHT--------ACVNRKCVDPCPGACGQFARCQ 12649
            |.||       |:         .||:..|.|..|.        |.||:.| :.|....|:...|.
Zfish  3364 CHPG-------CQCPEGSALQDGECVPVSLCHCHVNGEQHKPRATVNKDC-NNCTCESGKLVNCT 3420

  Fly 12650 VINHNPSCSCNTGYTGDPFTRCYQEERKPPTTPDNPCQPSPCGPNSECKVLNGNAACSCAATFIG 12714
            .::    |..:.|::.              .||...|..| ||                    :|
Zfish  3421 SVD----CDVDGGWSS--------------WTPWGVCSVS-CG--------------------VG 3446

  Fly 12715 TPPSCRPECSINPE-----CPPT------KACIRQKCS-----------DPCVNACGFNAR---- 12753
            .....| .|| :||     .|.|      :.|....||           ..|..:||...:    
Zfish  3447 LQSRYR-FCS-DPEPAGAGLPCTGAHRDDRVCASTPCSRDGGWSDWSSWTDCSKSCGGGVKSRRR 3509

  Fly 12754 -CNVANHQPICTCDVGYTGDPFTGCQKEQERIVNEQVTPCEPNPCGSNAVCRERNGIGSCQCLPD 12817
             |:    :||.|.|    ||...|        ::.:||.|....|          .:.||..:. 
Zfish  3510 DCD----RPIRTAD----GDQCEG--------LDTEVTLCNTQHC----------AVSSCSHVS- 3547

  Fly 12818 HFGDPYQSCRPECVRHSDCASNKACQQQKCRDPCPGTCG-----SNADCSVTNHLPTCTCRIGYT 12877
              |..:.:|.|.|.|  .|.....| :.:|...|..|.|     :..:|...:   :|.|....|
Zfish  3548 --GSVFSACGPSCPR--SCDDLTFC-EWRCEPGCYCTDGKVLTSNGTECVEQD---SCPCLDLNT 3604

  Fly 12878 GDPYRYCHVEPPQLPARVTEPSQPCRPSPCGPNSQCRELNGQAVCSCLELYIGLPPNCRPECVLS 12942
            |:     .|:|..     |.|:    |..|. |..|.  .|:..|:                  .
Zfish  3605 GE-----RVQPGD-----TVPT----PDACN-NCTCE--GGRLSCT------------------D 3634

  Fly 12943 TECPTDKACISQRCQDPCPGTCGINAECRVRNHSPLCQCRQGFTGDSFTRCYPLPPPPPVIE--- 13004
            ..||.|..........||..|||:....|.|:    |.|.:..:|.:           |..:   
Zfish  3635 HPCPVDGDWCQWSAWTPCSKTCGLEWVSRYRS----CSCPEPMSGGA-----------PCADQQE 3684

  Fly 13005 -------RVERDPCLP--SPCGLN---------SQCRNVQGVP----SCTCLPDFLGAPPNCRPE 13047
                   :::|.|| |  |.|.::         |:|....||.    .|...|...|..| |..|
Zfish  3685 EHAGLGVQIQRQPC-PSISYCPVDGSWGSWSSWSECDACAGVSVRQRQCHSPPARFGGLP-CMGE 3747

  Fly 13048 CTISAECPSNLACIRE--------RCIDPCPGSC--------------GYAAECSVVNHT----P 13086
            ...|..|..|.....:        .|..|||.||              ..:..|....||    .
Zfish  3748 SLQSRACHDNTTVCSDCGGGQQEWVCGKPCPRSCSDLHGDTECVDDPESCSLSCGCPGHTLLQDG 3812

  Fly 13087 ICVCP--------------------AGFTGDPFSSCRPAPPPEPTQSEYVDPCNPSPCGPNAQCN 13131
            :||.|                    ..::....|..:...|.|...|.    |:      |..|.
Zfish  3813 VCVEPEMCRCKYHNTSISAVSDSGNVSWSWSDASDWQITEPGETISSH----CH------NCTCE 3867

  Fly 13132 AGICTCLAEFHGDPYSGCRPECVLN-----SDCP---------RDKACHSSKCVNPCPGTCGENA 13182
            ||:..|      |...||..:...:     |||.         ||:     :|.||.|.:.|.  
Zfish  3868 AGVLQC------DSVPGCHVDGGWSQWGAWSDCSAQCGGGVKLRDR-----QCDNPTPQSGGR-- 3919

  Fly 13183 ICDVINHIPMCRCPERTAGSAFIRCSPVQITVSNP---------CRPSPCGPNSQCREVNQQAVC 13238
                     .|...||...    .|:....|.|.|         |..| ||..||.|.      .
Zfish  3920 ---------QCAGSERQQK----HCNTHNCTDSGPWLQWSRWSACTVS-CGGGSQSRS------R 3964

  Fly 13239 SCLPSFIGAPPSCRPECTSNSECAPTQACLNQRCGDPCPG----TCGVGANCAVVSHSPFCTCPE 13299
            ||      :.|.|..:...:..| .||.||...|.   ||    .|..|..|      || :|.:
Zfish  3965 SC------STPPCLGKRRQSKTC-NTQVCLEVGCP---PGRLYRECEHGEGC------PF-SCSQ 4012

  Fly 13300 RFTGNPFIRCQPQIEPPVRDVAPVDPCRPSPCGPYSQCRPVGEAPACSCVETYIGRPPNCRPECV 13364
                                |:.::.|       ||:    |....|.|       |||....  
Zfish  4013 --------------------VSGLEGC-------YSE----GCDEGCHC-------PPNTFQH-- 4037

  Fly 13365 TSSDCSSQLACVNQKCVDPCPGRCGLNAECFVVSHAVQCICQQGFNGDPFVQCKPEIAYE----- 13424
                        |..||..||  |.::::...   ::|.:.:           .|::.::     
Zfish  4038 ------------NGSCVSECP--CVVDSDLLT---SLQSVLE-----------TPDVTFDIHNIT 4074

  Fly 13425 --------NEIRTPCSPSPCGPNAVCRDRNGVGSCQCLP-------QYFGDPYEGCRPECMLDSD 13474
                    .|:...||...|        .:||.:|..||       ..:| |:..|...|.....
Zfish  4075 LGSELMSGEELMLECSSCSC--------EHGVWNCTLLPCPRDGGLSAWG-PWSSCSLSCGGLGQ 4130

  Fly 13475 CPSNRACQQLR-------CQDPCPGTCGLNANCQVVNHLPTCTCLTGYVGDPYRQCNRLPEPPQN 13532
            ...:|:|::.|       |:.|.               |.|..|.|       ..|.|:..|.:.
Zfish  4131 RSRSRSCEEPRPAHGGRDCEGPL---------------LDTAYCQT-------PDCPRVTVPTEE 4173

  Fly 13533 EYVNPCQPTPCGPNSQCRVSNEQAVCSCLPLFVGTPPSC-----------RPECTI---SSECSA 13583
                     |..|:.....|...|..||       ..||           :.||.:   |.|...
Zfish  4174 ---------PSLPDEDAGFSQWSAWSSC-------SRSCADPGSPGVKFRQRECVVELCSGETGQ 4222

  Fly 13584 DRACVNQKCVDPCAADTCGNNAICRVRNHS-------PICSCISGYTGDAFTRCFLIPPPIIETK 13641
            :|.|...:|.|   |..| ....|..||.|       .:||...|.......|.|:.|       
Zfish  4223 ERVCNLPQCPD---AGVC-QGLDCAQRNCSWMAWSDWSVCSRSCGVGQQQRIRTFIAP------- 4276

  Fly 13642 DEPLRDPCIPTPCGPNSECRNINGVPACSCLVNFIGQAPNCRPECTINSECPSQLA-------CI 13699
                                .:||                        |.||..|:       |.
Zfish  4277 --------------------GLNG------------------------SWCPDILSGNTETRFCN 4297

  Fly 13700 NQKCR-----------DPCPGACGQNAVCSVINHTPLCACIDGYIGNPFTNCNPKPPEPPAPPVA 13753
            .:.||           ..|...||                  |.......:|:..||:......|
Zfish  4298 IRACRVDGGWSRWSSWSRCDKGCG------------------GGRSIRTRSCSSPPPKNGGSKCA 4344

  Fly 13754 DD-----PCNPSPCGANAQCRNGQCSCIPEYKGDPYVSCRPECVLNTDCPRDRACVRNKCIDPCS 13813
            .:     |||..||| :..|..||          .:|||      :.:||:       :|.|...
Zfish  4345 GEKNQVKPCNTKPCG-DRGCPAGQ----------EFVSC------SNECPQ-------RCSDLQQ 4385

  Fly 13814 G-TCGVNALCEVNNHIPICRCPEQMSGNAFFECRPVPPAKIQNPCQPSPCGPNSQCRVVQQTAVC 13877
            | .|..|..|:     |.||||.                           |...|..|..||..|
Zfish  4386 GIQCHTNTECQ-----PGCRCPH---------------------------GQLLQDGVCVQTWQC 4418

  Fly 13878 SCL---ANYVGSPPQCRPECVTNSDCPADQDCQNMKCRD--------------PCPGTCGFNALC 13925
            .|:   .....|....:.:|.|.|...|...|.|..|.:              .|..:||..   
Zfish  4419 DCVDASGQVWASGSSHQQDCNTCSCTDAQITCSNHTCAEEKSSCTWSSWSTWASCSSSCGPG--- 4480

  Fly 13926 NVVNHRPFCSCPTGMSGNPFVSCQQLIIRDERPQNPCQPSPCGP-----NSECRV-----SGDSP 13980
               ....|.|......|:   |||    .:|....||.|.||.|     |.|..|     .|:..
Zfish  4481 ---QRTRFRSLVPEAEGS---SCQ----FEEVQHKPCDPGPCPPLCVHKNRELSVGDTWTDGECK 4535

  Fly 13981 SCSCLPEFVGAPPNCRPECISNSECPTNQACINQKCVDPCPGLCGQNAICRVFSHSAMCL----- 14040
            .|:|:||         .|...:.:|..:...........||..||::...|    :..|:     
Zfish  4536 QCTCIPE---------GEYCQDIDCQVDGGWTPWSVWSSCPVSCGKSKQIR----TRACINPPPR 4587

  Fly 14041 -----CDGGFTGDPFSQCSPIRDSPPEVLQPCNPSPC-------GVNAKCEERGGAG------SC 14087
                 |.|           |.||:     :.|:..||       ...::|....|||      .|
Zfish  4588 NNGSHCTG-----------PERDT-----RDCHSGPCLDDLCPWSTWSRCSVSCGAGLMSRRRQC 4636

  Fly 14088 QCLPDYFGNPYDGCRPECVLNSDCPSN--------QACVNQKCRDPCP-GTCGQNAECQVVNHLA 14143
            .|..|               ..||||:        |.|..:.| ..|| ......:||       
Zfish  4637 VCDED---------------EQDCPSDVQRDEEQTQMCYKRAC-PVCPMSEWSVWSEC------- 4678

  Fly 14144 TCNC---------LVGYTGDPYSICRITVNEPPERVYVNPCQPSPCGPNSQCRE---VNEQG-VC 14195
            .||.         ||..||..    |.|..|...|    ||:|..|   ..|.:   .:|.| .|
Zfish  4679 LCNSQFELRVRVPLVLSTGGQ----RCTDVEKQSR----PCRPQNC---KDCEKPFVFSECGSPC 4732

  Fly 14196 SCLPEFIGSPPAC--RPECTSSSECAADKACVNRKCVDPCPNVCGQQAECRVRNHNPI------- 14251
            ....:.:|...||  ...||....|.......|..||.  |:.||........:|.|:       
Zfish  4733 EKHCDLMGKADACMSSQNCTPGCYCPVGLVQQNGSCVR--PDQCGCVHLLLQDSHKPVTVTVPQG 4795

  Fly 14252 ------C-TCLSGFTGDPFTRCYRQPPPPPVVEREPLDPCVPSPC-GANSQCREIHGTPSCSCLP 14308
                  | |||   ..|...:|..:.....|.|......|  ||| ...|..|...     :||.
Zfish  4796 ALLTTGCRTCL---CHDGSLQCDLRECEVVVSEWSSWSSC--SPCVDLRSVQRRFR-----ACLH 4850

  Fly 14309 QYLGTP---PNCRPECSINAECPSHQACINQKCRDPCPGSCGLNTQCSVINHTPICSCLAGYIGD 14370
            ...|.|   ..|..|.....:||....     |||.|..|.                      ..
Zfish  4851 VESGEPVSGSQCDEELEEERDCPHADV-----CRDVCDWSS----------------------WS 4888

  Fly 14371 PFSVCNPEP----IPEKIRDPLPPEDPCNPSP-CG---SNTQ-CNNGVCSCLPEYHGDPYTGCRP 14426
            .:|||. ||    ...:.|.||..:    |.| |.   |.:| ||..:|   |..|      |. 
Zfish  4889 RWSVCK-EPCSGGFRHRERRPLTSD----PKPHCADLQSQSQSCNTALC---PGEH------CE- 4938

  Fly 14427 ECVLHTDCDRSRACVRHKCVDPCPGTCGTNAICEVLNHI--------PNCRCLEG--MQGNAFIQ 14481
                    ||.|. ....|.:.||.:|     .::.:|:        |.|||..|  :|..:   
Zfish  4939 --------DRGRV-FDGSCANQCPRSC-----ADLWDHVQCLQGVCHPGCRCPPGQLLQDGS--- 4986

  Fly 14482 CSPVPKLDV---VQNPCQPSPCGPN-----SQCRVVNQQAICS---C-ITSFIGSPPFCRPECTT 14534
            |.||.:...   :||.......|.|     :.|..||...:|:   | :....||...|...|.|
Zfish  4987 CVPVDECRCGLPMQNGTLEIRPGENITLSCNTCVCVNGSLVCTDHVCPLYGSWGSWSVCSVSCGT 5051

  Fly 14535 N--------SECPLNLAC----RNQKCS-DPCPGVCGRGAQCHVTNHSPFCRC---------LER 14577
            .        :...:.|:|    ::|.|| ..||      |.|.::..|.:..|         |.|
Zfish  5052 GQRTRVRSCTHTSVGLSCTHTIQSQNCSLSTCP------AGCVLSEWSSWSDCSASCGGGVSLRR 5110

  Fly 14578 YT-------GNPFVSCQQIIEPPVPPPRQTCLPS-PCGP-YSQCREVNESPSCTCLPEYIGAPPN 14633
            .|       |.  |||...:|........:|||. |.|. :|.|     :.||....|.:.....
Zfish  5111 KTVLQEPEAGG--VSCSGPLEQHTACNTNSCLPGCPAGQIFSSC-----AGSCPFSCEDLWPENQ 5168

  Fly 14634 CRP-ECVTSSECPTNQACIQQKC--RDPCPGLCGQSAECRVLS---------------HTP---- 14676
            |.| :|.....||:.:..:...|  :..||        |.|.|               ..|    
Zfish  5169 CVPLDCSAGCRCPSGEVMLNGTCVSQSQCP--------CSVFSLLLESTNSTLDFQDHEVPAGTV 5225

  Fly 14677 ------SCVCPEGMEGDPFTLCKEKRIQELDQLDPCSPSPCGINARCTSRQDAGS--CQCLPDYF 14733
                  ||||    ||..||...|....:.:.....|.|.|.::  |.|.|...|  ......|.
Zfish  5226 IPNSCNSCVC----EGGFFTCTNESCDVDCEWSSWSSWSSCSVS--CGSGQQFSSRTIHRQRQYA 5284

  Fly 14734 GNPYEG-------CR-PECVLNSDCP-----------SNKACQQQKCQD---PCPGTCGQNALCN 14776
            |...||       || |||    :||           |.:.| ::.|.|   |.|..|.......
Zfish  5285 GQECEGPTHTSQTCRSPEC----ECPAGERWLWADSGSERVC-ERGCLDLYSPEPLNCSGPGTAE 5344

  Fly 14777 VLNHIPSCSCISGYSGDPYRS----CV--------------PEPVKEYVNPCQPSPCGPNSQCRE 14823
                  .|.|.:|    .|||    ||              .:|..|:|:.||        .||.
Zfish  5345 ------GCVCEAG----RYRSLEGQCVIPALCECEDEDGTLQQPGSEWVDGCQ--------SCRC 5391

  Fly 14824 VNEQAIC--SCLPEYVGAPPV-------CRPECTISSECPADKACVNQKCVDPCPNTCGDQAICR 14879
            ||.|..|  :|.|.:.....|       |.|.|.:  :.|.|.....::..:....|.||   ||
Zfish  5392 VNGQKHCQSNCPPLHCSEGEVKVLEAGDCCPVCRM--QFPEDPVAECRRHTEVRNITKGD---CR 5451

  Fly 14880 VVNHSPICSCRAGYTGDAFFRCFPKPPVPPTPVQKTPVDPCVPTPCGPYSQCRSQGDAPACSCLV 14944
            :.| ..:..||.        ||..:..|....               ||.|.       .|.| .
Zfish  5452 LDN-VEVSFCRG--------RCLSRTDVILEE---------------PYLQA-------FCDC-C 5484

  Fly 14945 GYIGAPPNCRPECRINAECPSSQACINEKCRDPCPGSCGYGAICNVINHTPSCTCPPGYSGD 15006
            .|...|.|  |...:|..|.|...       :|        .:..||:   ||.|.....||
Zfish  5485 SYKLDPQN--PVRFLNLRCASGDL-------EP--------VVLPVIH---SCECTSCQGGD 5526

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dpyNP_001260032.1 EGF_3 137..166 CDD:289699
EGF_CA 212..247 CDD:238011
EGF_CA 255..>286 CDD:214542
EGF_CA 298..331 CDD:238011
EGF_CA 338..373 CDD:238011
EGF_CA 413..456 CDD:238011
EGF_CA 457..490 CDD:238011
EGF_CA 497..>529 CDD:214542
EGF_CA 580..>612 CDD:214542
EGF_3 676..702 CDD:289699
EGF_CA 1022..1056 CDD:214542
EGF_CA 2227..2260 CDD:238011
EGF_CA 2393..>2422 CDD:214542
DUF4758 4088..4282 CDD:292572
DUF4696 4127..4678 CDD:292395
DUF4758 4275..4448 CDD:292572
DUF4758 4377..4574 CDD:292572
DUF4758 4581..4754 CDD:292572
DUF4758 4683..4847 CDD:292572
DUF4758 4785..4964 CDD:292572
DUF4696 4841..5385 CDD:292395
DUF4758 4887..5098 CDD:292572
DUF4758 5193..5371 CDD:292572
DUF4758 5294..5487 CDD:292572
DUF4758 5445..5650 CDD:292572
DUF4758 5700..5877 CDD:292572
DUF4696 5756..6396 CDD:292395
DUF4758 5802..5979 CDD:292572
DUF4758 5964..6171 CDD:292572
DUF4758 6181..6360 CDD:292572
DUF4696 6339..6999 CDD:292395
DUF4758 6662..6839 CDD:292572
DUF4758 6764..6941 CDD:292572
DUF4758 6866..7045 CDD:292572
DUF4758 6968..7179 CDD:292572
DUF4696 7024..7569 CDD:292395
DUF4758 7172..7383 CDD:292572
DUF4696 7330..7964 CDD:292395
DUF4758 7400..7587 CDD:292572
DUF4758 7538..7707 CDD:292572
DUF4758 7798..7979 CDD:292572
DUF4758 7946..8126 CDD:292572
YppG 18767..>18832 CDD:290883
Med25_SD1 18795..18955 CDD:288132
MISS 19026..19258 CDD:292450
ZP 22576..22811 CDD:214579
Zona_pellucida <22714..22810 CDD:278526
scospondinXP_021325919.1 VWD 190..342 CDD:214566 29/165 (18%)
C8 392..458 CDD:312319 12/66 (18%)
TIL 462..517 CDD:307783 20/71 (28%)
VWD 557..706 CDD:321964 32/183 (17%)
C8 745..814 CDD:214843 23/104 (22%)
TIL 817..876 CDD:307783 12/61 (20%)
VWD 1009..1157 CDD:306577 28/166 (17%)
C8 1196..1269 CDD:214843 21/107 (20%)
TIL 1272..1328 CDD:307783 17/87 (20%)
LDLa 1409..1439 CDD:197566 5/31 (16%)
LDLa 1445..1479 CDD:238060 10/68 (15%)
LDLa 1488..1524 CDD:238060 14/68 (21%)
LDLa 1528..1562 CDD:238060 10/42 (24%)
LDLa 1564..1598 CDD:238060 14/50 (28%)
LDLa 1603..1637 CDD:238060 11/55 (20%)
LDLa 1640..1673 CDD:197566 10/68 (15%)
LDLa 1687..1719 CDD:238060 11/50 (22%)
TSP1 1775..1821 CDD:214559 11/55 (20%)
TSP1 1827..1886 CDD:214559 18/85 (21%)
TIL 1885..1940 CDD:307783 13/71 (18%)
TSP1 1984..2037 CDD:214559 19/126 (15%)
FA58C 2144..2309 CDD:238014 38/208 (18%)
LDLa 2320..2357 CDD:238060 13/50 (26%)
FA58C 2400..2551 CDD:330301 22/165 (13%)
LDLa 2646..2680 CDD:238060 7/34 (21%)
LDLa 2702..2736 CDD:238060 10/47 (21%)
TSP1 2742..2791 CDD:214559 14/97 (14%)
TSP1 2796..2847 CDD:214559 15/72 (21%)
TIL 2875..2917 CDD:307783 15/48 (31%)
TSP1 2960..3009 CDD:214559 9/57 (16%)
TSP1 3019..3070 CDD:214559 12/64 (19%)
TSP1 3232..3283 CDD:214559 12/57 (21%)
TSP1 3288..3329 CDD:214559 14/50 (28%)
TIL 3335..3387 CDD:307783 11/59 (19%)
TSP1 3430..3482 CDD:214559 16/89 (18%)
TSP1 3487..3538 CDD:214559 14/67 (21%)
TIL 3548..3597 CDD:307783 12/55 (22%)
TSP1 3643..>3685 CDD:214559 11/57 (19%)
TSP1 3885..3936 CDD:214559 14/71 (20%)
TSP1 3942..3986 CDD:214559 14/58 (24%)
TSP1 4113..4165 CDD:214559 14/75 (19%)
TSP1 4184..4232 CDD:214559 13/55 (24%)
TSP1 4249..4301 CDD:214559 13/103 (13%)
TSP1 4307..4358 CDD:214559 12/69 (17%)
TIL 4363..4418 CDD:307783 24/110 (22%)
TSP1 4557..4608 CDD:214559 13/71 (18%)
TSP1 4614..4665 CDD:214559 14/67 (21%)
TIL 4719..4774 CDD:307783 14/57 (25%)
TSP1 4884..4933 CDD:214559 17/79 (22%)
TIL 4948..4993 CDD:307783 14/53 (26%)
TSP1 5037..5084 CDD:214559 11/47 (23%)
TSP1 5090..5139 CDD:214559 10/51 (20%)
TIL 5143..5197 CDD:307783 13/59 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4475
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126579
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.800

Return to query results.
Submit another query.