DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31524 and p4htm

DIOPT Version :8

Sequence 1:NP_733379.2 Gene:CG31524 / 318781 FlyBaseID:FBgn0051524 Length:536 Species:Drosophila melanogaster
Sequence 2:XP_001340234.2 Gene:p4htm / 799930 ZFINID:ZDB-GENE-110131-7 Length:510 Species:Danio rerio

Alignment Length:299 Identity:76/300 (25%)
Similarity:113/300 (38%) Gaps:90/300 (30%)


  Fly   314 LRLAPIKTEILS---------VDPFVILLHDMVSHKEGALIRSSSKNQI-------LPSETVNAA 362
            |.|:|  .||.:         :.|..||.|..|  ::|..:.|.:..:|       |....:.:.
Zfish   199 LNLSP--EEIFNFLDLNQDGQLQPHEILTHSRV--RDGIWLTSENLKEIYDGLKADLDGNGLLSL 259

  Fly   363 NEF------EIAKF------------RTSKSVWF--DSDANEATLKLTQRLGEATGLD---MKHS 404
            .||      ...:|            |.|:..|.  ...|::....|.:|:...|.|.   ::.|
Zfish   260 EEFGRLRSDAFQRFLLQRGVERSQLVRNSRHTWLYQGQGAHQVLQDLRKRVTLLTRLPSSLVELS 324

  Fly   405 EPFQVINYGIGGVFESHFD------------TSLADEDRFVNGYIDRLATTLFYLNDVPQGGATH 457
            ||.||:.|..||.:.:|.|            |.||...........|..|.|||||:|.:||.|.
Zfish   325 EPLQVVRYEQGGHYHAHHDSGPVYPETACTHTRLAANTTSPFQTSCRYITVLFYLNNVQEGGETT 389

  Fly   458 FPGL---------------------------NITVFPKFGTVLMWYNLHTEGMLHV-----RTMH 490
            ||..                           |:.|.|..||.:.|||..::|...|     .::|
Zfish   390 FPVADNRTYEEASLIQNDVDLLDTRKHCDKGNLRVKPVKGTAVFWYNYLSDGRGWVGEQDEYSLH 454

  Fly   491 TGCPVIVGSKWVVSKWID---DKGQEFRRPCLRSRLDSK 526
            .||.|..|:|||.:.||:   |..::.|...|.|:.:|:
Zfish   455 GGCVVTQGTKWVANNWINVDPDYQRQARYQLLVSQQESQ 493

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31524NP_733379.2 P4Ha_N 31..157 CDD:285528
TPR_11 215..>259 CDD:290150
TPR_2 216..249 CDD:285020
P4Hc 340..507 CDD:214780 60/241 (25%)
p4htmXP_001340234.2 EF-hand_7 204..262 CDD:290234 12/60 (20%)
EFh 204..262 CDD:298682 12/60 (20%)
P4Hc 285..471 CDD:214780 53/186 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92048294
eggNOG 1 0.900 E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.