DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Or82a and Or33a

Sequence 1:NP_730794.1 Gene:Or82a FlyBaseID:FBgn0041621 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_523553.1 Gene:Or33a FlyBaseID:FBgn0026392 Length:378 Species:Drosophila melanogaster

Alignment Length:386 Identity:82/387 (21%)
Similarity:158/387 (41%) Gaps:78/387 (20%)


  Fly    41 ISAQYPLISYVAYNRNDMEKVTACLSVVFTNMLTVIKISTFLANRKDFWEMIHRFRKMHEQSASH 105
            :...||....|.:.      :|:.::::|       .:...|...|.  ..|..||.:|..|...
  Fly    25 VEGDYPFRRLVDFT------ITSFITILF-------PVHLILGMYKK--PQIQVFRSLHFTSECL 74

  Fly   106 IPRYR--------------EG----LDYVAEA-----------NKLASFLGRAYCV-------SC 134
            ...|:              ||    ||...|:           :::|..|.::|.|       :.
  Fly    75 FCSYKFFCFRWKLKEIKTIEGLLQDLDSRVESEEERNYFNQNPSRVARMLSKSYLVAAISAIITA 139

  Fly   135 GLTGLYFMLGPIVKIGVCRWHGTTCDKELPMPMKFPFNDLESPG--YEVCFLYTVLVTVVVVAYA 197
            .:.||:.....::.:|   |              ||: |.::..  |.:.|.|..:.:.:::...
  Fly   140 TVAGLFSTGRNLMYLG---W--------------FPY-DFQATAAIYWISFSYQAIGSSLLILEN 186

  Fly   198 SAVDGL-FISFAI---NLRAHFQTLQRQIENWEFPSSEPDTQIRLKSIVEYHVLLLSLSRKLRSI 258
            .|.|.. .|:|.:   ::|.....|.|...:.:..||| :|:..::.|.: |..|:.:.|.|||.
  Fly   187 LANDSYPPITFCVVSGHVRLLIMRLSRIGHDVKLSSSE-NTRKLIEGIQD-HRKLMKIIRLLRST 249

  Fly   259 YTPTVMGQFVITSLQVGVIIYQLVTNMDSVMDLLLYASFFGSIMLQLFIYCYGGEIIKAESLQVD 323
            ...:.:|||:.:.:.:.:.:..::...::...:|.||.||.:::::||..||.|.::..|..::.
  Fly   250 LHLSQLGQFLSSGINISITLINILFFAENNFAMLYYAVFFAAMLIELFPSCYYGILMTMEFDKLP 314

  Fly   324 TAVRLSNWHLASPKTRTSLSLIILQSQKEVLIRAGFFVA-SLANFVGICRTALSLITLIKS 383
            .|:..|||.....:...||.:::..:...|.|:||..|. .::.|....|.|.|..||..|
  Fly   315 YAIFSSNWLKMDKRYNRSLIILMQLTLVPVNIKAGGIVGIDMSAFFATVRMAYSFYTLALS 375

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Or82aNP_730794.1 7tm_6 65..374 CDD:251636 73/352 (21%)
Or33aNP_523553.1 7tm_6 61..367 CDD:251636 71/326 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C50249
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21137
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.