DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31473 and PDX3

Sequence 1:NP_731188.1 Gene:CG31473 FlyBaseID:FBgn0051473 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_009591.1 Gene:PDX3 SGDID:S000000239 Length:228 Species:Saccharomyces cerevisiae

Alignment Length:181 Identity:49/182 (27%)
Similarity:83/182 (46%) Gaps:18/182 (10%)


  Fly    40 EQRVYEEPHVIFQNWLMAAQKEAPQVRPRLACMATVD-KSGEPVTRLTSIEEVNSHGITFFTTLG 103
            |:::.::|..:|..|...|:::..:..|.....::.: .||...:|:...:|::..|.|.::..|
Yeast    28 EKQLTDDPIDLFTKWFNEAKEDPRETLPEAITFSSAELPSGRVSSRILLFKELDHRGFTIYSNWG 92

  Fly   104 -SRQAGEISANPHVSLHFNWAPLMRSVRIAGSAHQLTEEQVRDQFRRFPRHVQMSITHGPRYAAA 167
             ||:|.:|:.||:.::.|.|..|.|.||:.|....:..|.....|:..||        |.:..| 
Yeast    93 TSRKAHDIATNPNAAIVFFWKDLQRQVRVEGITEHVNRETSERYFKTRPR--------GSKIGA- 148

  Fly   168 EWQSRSGFFARIGQRL------NTWLGKQPEEIPMPHNWGGYILTPSLYEF 212
             |.||.....:..:.|      ||...|..|:||.|..|||..:.|...||
Yeast   149 -WASRQSDVIKNREELDELTQKNTERFKDAEDIPCPDYWGGLRIVPLEIEF 198

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31473NP_731188.1 PRK05679 40..229 CDD:235555 49/182 (27%)
Pyridox_oxidase 66..142 CDD:279568 22/78 (28%)
PDX3NP_009591.1 PdxH 13..228 CDD:223337 49/182 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C173967363
eggNOG 1 0.900 E1_COG0259
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S1192
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10851
Phylome 1 0.910 0.644 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.750

Return to query results.
Submit another query.