DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31473 and Pnpo

Sequence 1:NP_731188.1 Gene:CG31473 FlyBaseID:FBgn0051473 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_072123.1 Gene:Pnpo RGDID:621456 Length:261 Species:Rattus norvegicus

Alignment Length:231 Identity:69/232 (30%)
Similarity:105/232 (45%) Gaps:35/232 (15%)


  Fly    40 EQRVYEEPHVI-------FQNWLMAAQKEAPQV-RPRLACMATVDKSGEPVTRLTSIEEVNSHGI 96
            ::..:||.|:.       |.:|...| .:.|.: .....|:||..:.|:|..|:..::.....|.
  Rat    44 DREAFEEAHLTSLDPMKQFASWFEEA-VQCPDIGEANAMCLATCTRDGKPSARMLLLKGFGKDGF 107

  Fly    97 TFFTTLGSRQAGEISANPHVSLHFNWAPLMRSVRIAGSAHQLTEEQVRDQFRRFPRHVQMSITHG 161
            .|||...||:..|:.:||..||.|.|.||.|.||:.|...:|.|::..:.|...|:..|:.    
  Rat   108 RFFTNYESRKGKELDSNPFASLVFYWEPLNRQVRVEGPVKKLPEKEAENYFHSRPKSSQIG---- 168

  Fly   162 PRYAAAEWQSRSGFFARIGQRLNTWLGK--QPEEIPMPHNWGGYILTPSLYEFGMLSGEKAGRT- 223
               |....||.........::.|..||:  :.:|:|.|..||||||.|.:.||..      |:| 
  Rat   169 ---AVVSRQSSVIPDREYLRKKNEELGQLYREQEVPKPEYWGGYILYPQVMEFWQ------GQTN 224

  Fly   224 ----RVRFRRCL---EMPRGTRVGHVQAERQDWVYD 252
                |:.|||.|   :.|.|....|.:   :||||:
  Rat   225 RLHDRIVFRRGLATGDSPLGPMTHHGE---EDWVYE 257

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31473NP_731188.1 PRK05679 40..229 CDD:235555 60/204 (29%)
Pyridox_oxidase 66..142 CDD:279568 27/76 (36%)
PnpoNP_072123.1 Pyridoxal 5'-phosphate binding. {ECO:0000250|UniProtKB:P0AFI7} 42..45 0/1 (0%)
pdxH 57..261 CDD:273138 66/219 (30%)
Pyridox_oxidase 75..153 CDD:279568 27/78 (35%)
PNPOx_C 206..261 CDD:287549 23/62 (37%)
Pyridoxal 5'-phosphate binding. {ECO:0000250|UniProtKB:P0AFI7} 225..227 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C173950674
eggNOG 1 0.900 E1_COG0259
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1337072at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10851
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.