| Sequence 1: | NP_732700.2 | Gene: | Ir94b / 318728 | FlyBaseID: | FBgn0051424 | Length: | 592 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001137966.2 | Gene: | Ir75b / 8673994 | FlyBaseID: | FBgn0261402 | Length: | 605 | Species: | Drosophila melanogaster | 
| Alignment Length: | 692 | Identity: | 121/692 - (17%) | 
|---|---|---|---|
| Similarity: | 219/692 - (31%) | Gaps: | 255/692 - (36%) | 
- Green bases have known domain annotations that are detailed below.
| 
 
  Fly    29 LNNIVRSMIKLHKMETLVIVKHHLDNNCSLQNWNAHGMGIIRTNDQGKLIMKDTFNSRTLAIICI 93 
  Fly    94 GQNSHITLL---RNVFETFGKVQQKKIILWTQMELKEKFFQEISKKSRDLKLLNLLVLKAVTKDK 155 
  Fly   156 -------------------LLIY-RLNPFP--SPHFKRIENIWTPNDTLFMDTKFNFHGMTAVVK 198 
  Fly   199 HD-----------YNWTIQMGNIRKFPISRIEDKEV----------------------------- 223 
  Fly   224 --------IEFALKYNLTLQ----FFNDVERFDIELRKRIILKSNSTQPIDSGIPMVFSSL---- 272 
  Fly   273 --------------------LIVVP----CGNYLSIQDVIKVS----------------GIEKWI 297 
  Fly   298 FY------IILVYVIFVLIEITFLGVTILISRQSRHQMIPNTLVN-LCAFRA--ILGLPFPETRR 353 
  Fly   354 TSLSLRQLFLAIALFG-MIFSIFINCKLSSMLTNPCPRPQVNNFEELKTSGLTVVM--------- 408 
  Fly   409 -----DHDAENFIEKEIGVDFFNQYMPRKVTLTFTERAKLLFSLKGNHAFTLFSESFAIIESYQR 468 
  Fly   469 SKGLRAHCTSEDLIVAERVPRIYILENNSILDR--PLRRFIR----QMQESGI----TNHWLKNI 523 
  Fly   524 PSSLEKNLMQITIPYDRERVHPLSIEHL-TWLWCILILGYSI 564  | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| Ir94b | NP_732700.2 | None | |||
| Ir75b | NP_001137966.2 | Periplasmic_Binding_Protein_Type_2 | 253..553 | CDD:304360 | 55/317 (17%) | 
| Lig_chan | 343..585 | CDD:278489 | 50/262 (19%) | ||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR42643 | 
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||