DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ir94b and Ir75b

Sequence 1:NP_732700.2 Gene:Ir94b FlyBaseID:FBgn0051424 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_001137966.2 Gene:Ir75b FlyBaseID:FBgn0261402 Length:605 Species:Drosophila melanogaster

Alignment Length:692 Identity:121/693 (17%)
Similarity:219/693 (32%) Gaps:255/693 (37%)


  Fly    29 LNNIVRSMIKLHKMETLVIVKHHLDNNCSLQNWNAHGMGIIRTNDQGKLIMKDTFNSRTLAIICI 93
            |:|::     ||.:..:..:.|.|..:|||                                   
  Fly     4 LHNLI-----LHNLIHMAKLSHVLILHCSL----------------------------------- 28

  Fly    94 GQNSHITLL---RNVFETFGKVQQKKIILWTQMELKEKFFQEISKKSRDLKLLNLLVLKAVTKDK 155
               ||:.||   :|:|..|..       |.:.::|.:.|...        .:|.|.|...:..||
  Fly    29 ---SHLALLAQSKNIFTQFQP-------LHSDIQLNDDFLNH--------NILKLGVFLDINCDK 75

  Fly   156 -------------------LLIY-RLNPFP--SPHFKRIENIWTPNDTLFMDTKFNFHGMTAVVK 198
                               .||| |...|.  ..|||..:        :|:|....:      |.
  Fly    76 SGTVLDMASAKRFFSHRYHWLIYDRSMNFSVLESHFKEAQ--------IFVDADVTY------VT 126

  Fly   199 HD-----------YNWTIQMGNIRKFPISRIEDKEV----------------------------- 223
            ||           ||...|:|.    .::...|:|:                             
  Fly   127 HDPFSKNFLLYDVYNKGRQLGG----ELNITADREIFCNKTNCRVERYLSELYTRSALQHRKSFT 187

  Fly   224 --------IEFALKYNLTLQ----FFNDVERFDIELRKRIILKSNSTQPIDSGIPMVFSSL---- 272
                    :..||..|::::    |.|...|..::...|  |...:.||:...:...|..:    
  Fly   188 GLTMRATAVVTALPLNVSIKEIFDFMNSKYRIQLDTYAR--LGYQARQPLRDMLDCKFKYIFRDR 250

  Fly   273 --------------------LIVVP----CGNYLSIQDVIKVS----------------GIEKWI 297
                                |.:.|    ....|.:|.:.|.|                |:....
  Fly   251 WSDGNATGGMIGDLILDKADLAIAPFIYSFDRALFLQPITKFSVFREICMFRNPRSVSAGLSATE 315

  Fly   298 FY------IILVYVIFVLIEITFLGVTILISRQSRHQMIPNTLVN-LCAFRA--ILGLPFPETRR 353
            |.      :.|.:.:.:|:....|.||.::.|  |.|..|:.|.: |.:|.|  |.|...  |.|
  Fly   316 FLQPFSGGVWLTFALLLLLAGCLLWVTFILER--RKQWKPSLLTSCLLSFGAGCIQGAWL--TPR 376

  Fly   354 TSLSLRQLFLAIALFG-MIFSIFINCKLSSMLTNPCPRPQVNNFEELKTSGLTVVM--------- 408
             |:..|..|.|:.:.. ::::.:.:..:|.:|..|. :..:...::|..|.|.|.:         
  Fly   377 -SMGGRMAFFALMVTSYLMYNYYTSIVVSKLLGQPI-KSNIRTLQQLADSNLDVGIEPTVYTRIY 439

  Fly   409 -----DHDAENFIEKEIGVDFFNQYMPRKVTLTFTERAKLLFSLKGNHAFTLFSESFAIIESYQR 468
                 :.|..:...|::   ..::..|.|:.:. ||...|  |::....|...:   .:...|: 
  Fly   440 VETSEEPDVRDLYRKKV---LGSKRSPDKIWIP-TEAGVL--SVRDQEGFVYIT---GVATGYE- 494

  Fly   469 SKGLRAHCTSEDLIVAERVPRIYILENNSILDR--PLRRFIR----QMQESGI----TNHWLKNI 523
              .:|.|..:..:.....:|.......:::|.:  |....|:    :|.|:|:    ...|::..
  Fly   495 --FVRKHFLAHQICELNEIPLRDASHTHTVLAKRSPYAELIKLSELRMLETGVHFKHERSWMETK 557

  Fly   524 PSSLEKNLMQITIPYDRERVHPLSIEHL-TWLWCILILGYSI 564
            ....:.|   .|:....|...||.|..| ..:.|:.|||..:
  Fly   558 LHCYQHN---HTVAVGLEYAAPLFIILLGAIILCMGILGLEV 596

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ir94bNP_732700.2 None
Ir75bNP_001137966.2 Periplasmic_Binding_Protein_Type_2 253..553 CDD:304360 55/318 (17%)
Lig_chan 343..585 CDD:278489 50/263 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.