DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ir94b and Ir7e

Sequence 1:NP_732700.2 Gene:Ir94b FlyBaseID:FBgn0051424 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_001138176.1 Gene:Ir7e FlyBaseID:FBgn0259189 Length:608 Species:Drosophila melanogaster

Alignment Length:395 Identity:78/396 (20%)
Similarity:159/396 (40%) Gaps:63/396 (16%)


  Fly   219 EDKEVIEFALKYNLTLQFFNDVERFDIELRKRII--LKSNSTQPIDSGIPMVFSSLLIVVPCGNY 281
            |.:.::..|.|.|.|:.    |.:..:.:|...:  |:.:.......||....:..::.....||
  Fly   240 EGRLLLALAEKMNFTIA----VRKVHVNMRDEALEMLRRDEVDLTLGGIRQTVARGMVATSSHNY 300

  Fly   282 LSIQDVIKV--SGIEKWIFYIILVYVIFVLIEITFLGVT-------ILISRQSRHQMIPNTLVNL 337
            ...::|..|  |..|...| .||.|...:.|.:..|||.       :::.|..|.:|.....:||
  Fly   301 HQTREVFGVLASSYELSSF-DILFYPYRLQIWMGILGVVALSALIQLIVGRMLRERMGSRFWLNL 364

  Fly   338 CAFRAILGLPFPETRRTSLSLRQLFLAIALFGMIFSIFINCKLSSMLTNPCPRPQVNNF----EE 398
              ....:|:|..|..|:..:  :|:..:.   |::::.|......:|.:.....|:|.:    |.
  Fly   365 --ELVFVGMPLLECPRSHTA--RLYCVML---MMYTLIIRTIYQGLLYHLIRTHQLNRWPQTIES 422

  Fly   399 LKTSGLTVVMDHDAENFIEKEIGVDFFNQYMPRKVTLTFTERAKLLFSLKGNH------------ 451
            |.....|||:....:..:::...|    |:|..::....:|...|.| |:.||            
  Fly   423 LVQKNFTVVLTPIVQEVLDEIPSV----QHMRFRLLEANSELDPLYF-LEANHQLRQHVTASALD 482

  Fly   452 AFTLFSESFA--IIESYQRSKGLRAHCTSEDLIVAERVPRIYILENNSILDRPLRRFIRQMQESG 514
            .|..|:...|  :.:..::..|.......||:|..:..  :|:.:::.::|: |...|..|:..|
  Fly   483 IFIHFNRLSADKVHQRGEQGSGAHFEIVPEDIISMQLT--MYLAKHSFLIDQ-LNEEIMWMRSVG 544

  Fly   515 ITNHWLK-NIPSSLEKNLMQITIPYDRERVHPLSIEHLTWLWCILILGYSISMIVFFVEM----S 574
            :.:.|.: .:..|..:|.....:         |....|..::.::::|..:.::||.:|:    |
  Fly   545 LLSVWSRWELSESYLRNEQSFQV---------LGTMELYAIFLMVLVGLIVGLLVFILELVSMRS 600

  Fly   575 LKRRK 579
            :..||
  Fly   601 IYLRK 605

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ir94bNP_732700.2 None
Ir7eNP_001138176.1 PBPb 218..>313 CDD:214497 15/77 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.