DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ir94b and Ir7d

Sequence 1:NP_732700.2 Gene:Ir94b FlyBaseID:FBgn0051424 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_001138175.1 Gene:Ir7d FlyBaseID:FBgn0259190 Length:594 Species:Drosophila melanogaster

Alignment Length:684 Identity:121/685 (18%)
Similarity:226/685 (33%) Gaps:244/685 (36%)


  Fly    32 IVRSMIKLHKMETLVIVKHHL-------DNNCSLQNWNAHGMGI------IRTN----DQGKLIM 79
            :|..::.|.|::.:|....||       ..:.:||....:|:.:      |.|:    |:.::|:
  Fly     6 VVALLLGLCKVQAVVWPHQHLLEEQLASQISATLQKIFINGLAVYNFGVFISTSYEEMDRDRVIL 70

  Fly    80 KDTFNSRTLAIICIGQNSHITLLRNVFETFGKVQQKKIILWTQMELK---EKFFQEISKKSRDLK 141
                             .|..|.||::.....|   .::|.::|..|   :.|.|.:..::.:..
  Fly    71 -----------------VHQVLNRNLYPPNFPV---AVVLASKMNRKITAQVFTQLLFVQNAEQA 115

  Fly   142 LLNLLVLKAVTKDKL-LIYRLNPFPSPHFKRIENIWTPNDTLFMDTKFN---------FHGMTAV 196
               :.:.:.|.::.| :|..|...|.      ..|.|...|.||..::|         .||:.|.
  Fly   116 ---IAIAEGVNRNGLCVIVLLTSQPE------RPIMTKIFTYFMQERYNINVVILVPRLHGVQAF 171

  Fly   197 VKHDYN-------------------WTI---QMGNIRKFPIS----------RIEDK-------- 221
            ....|.                   |.:   ::.|:...|:|          ||..|        
  Fly   172 NVRPYTPTSCSSLEPVEIDIKDGDLWDVFPRRLKNLHGCPLSVIVWDIPPYMRINWKSSDPMDGL 236

  Fly   222 --------EVIEFALKYNLTLQF------------------FNDVERFDIELRKRIILKSNSTQP 260
                    .::  |.|.|.||:.                  |....:...|.|..|.:...:..|
  Fly   237 DGLDGLLLRIV--ARKMNFTLKLIPNEPNGLIGGSSFMNGTFTGAYKMLRERRANITIGCAACTP 299

  Fly   261 -----IDSGIPMVFSSLLIVVPCGNYLSIQDVIKVSGIEKWIFYIILVYVIFVLIEITFLGVTIL 320
                 :::..|....|.:||:......||.:|: :...||:.:          |:..|.||:..:
  Fly   300 ERSTFLEATSPYSQMSYIIVLQARGGYSIYEVM-LFPFEKYTW----------LLLSTILGLHWI 353

  Fly   321 ISRQSRHQMIPNTLVNLCAFRAILGLPFPETRRTSLSLRQLFLAIALFGMIFSIFI-----NCKL 380
            :..:.|                   :|.|                .|.|.:..||:     ...:
  Fly   354 VGSRWR-------------------MPSP----------------ILAGWMLWIFVIRASYEASV 383

  Fly   381 SSMLTNPCPRPQVNNFEELKTSGLTVVMDH------------DAENFIEKEIGVDFFNQYM--PR 431
            .:.:.|...:|.....::..:.|...:.||            ..:..|.....||.|:..:  |.
  Fly   384 FNFIQNSPVKPSPRTLDQALSGGFRFITDHASYRMTLKIPSFQGKTLISAGQPVDVFDALLKAPW 448

  Fly   432 KVTLTFTERAKLLFSLKGNHAFTLFSESFAIIESYQRSKGLRAHCTSEDLIVAERVPRIYILENN 496
            | |..||.||.|...|..:                      |.| .::.:|:||:     |::|.
  Fly   449 K-TGAFTSRAFLADHLVRH----------------------RKH-RNQLVILAEK-----IVDNM 484

  Fly   497 SILDRP--------LRRFIRQMQESGITNH------WLKNIPSSLEKNLMQITIPYDRERVHPLS 547
            ..:..|        :.:.:..|:..||..|      | .|:|::.:.:.....|....|.|....
  Fly   485 LCMYFPHGSYFAWEINKLLFNMRSFGIFQHHSQILAW-DNLPTTTDTDTPGKRIHSSTESVATGF 548

  Fly   548 IEHLTWLWCIL--ILG-YSISMIVFFVEMSLKRR 578
            .|.::::...|  ::| ..||::||.:|:..:||
  Fly   549 AESMSFVVAALNCLMGALCISIVVFGLELLSRRR 582



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.