DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ir94b and Ir100a

Sequence 1:NP_732700.2 Gene:Ir94b FlyBaseID:FBgn0051424 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_651898.2 Gene:Ir100a FlyBaseID:FBgn0039879 Length:603 Species:Drosophila melanogaster

Alignment Length:696 Identity:121/697 (17%)
Similarity:234/697 (34%) Gaps:214/697 (31%)


  Fly     1 MSLIFNLLFILILSQAVSQETEFLQLKYLNNIVRSM---IKLH---------------------- 40
            |:....|:.:.::...:.|.......:.|.:||:.:   ::||                      
  Fly     1 MATTLQLIMLALVGGTLGQANNTDHKQVLTSIVKQLEGGLELHLRTSEDGGNDLVQFLMQEKSSI 65

  Fly    41 ----KMETL----VIVKHH---LDNNCSLQNWNAHGMGIIRTNDQGKLIMKDTFNSRTLAIICIG 94
                |.|.:    .|::||   .|        ..|.|..|||:         .||:....|:.:.
  Fly    66 IISAKQEEVPSRAKIMRHHFFIFD--------GVHQMQEIRTS---------LFNTDGFYILALE 113

  Fly    95 QNSHITLLRNVFETFGKVQQKKIILWTQMELKEKFFQEISKKSRDLKLLNLLVLKAVTKDKLLIY 159
            .|   |:..:|.     :.:....:|.|......::.::||||                  :|::
  Fly   114 NN---TIEDDVL-----LMEFAADVWLQHGHSRIYYVQLSKKS------------------VLLF 152

  Fly   160 RLNPFPSPHFKRIENIWTPNDT-----LFMDTKFNFHGMTAVVKHDYNWTIQMGNIRKFPISRIE 219
              |||       ::.:....|:     ::.|.: .:|....:....|:..|..|..:...::..:
  Fly   153 --NPF-------LQRLVVVQDSKTYSRIYKDLE-GYHLRIYIFDSVYSSVIGDGENKVLSVTGAD 207

  Fly   220 DKEVIEFALKYNLTLQF-FNDVERFDIELRK--------------------RIILKSNSTQPIDS 263
            .|.....|.:.|.|..| :.|.|.|...|..                    ...:|...|..|..
  Fly   208 AKLAKTVARQLNFTADFVWPDDEFFGGRLANGEYSGGVGRAHRGEVDIIFAGFFIKDYLTTHIQF 272

  Fly   264 GIPMVFSSLLIVVPCGNYLSIQDVIKVSGI--EKWIFYIILVYVIFVLIEITFLGVTILI----- 321
            ...:....|.:.|.....:. |.::.:..:  :.|:.: :||.::..|:.:....|.:::     
  Fly   273 SAAVYMDELCLYVKKAQRIP-QSILPLFAVHMDVWLCF-LLVGLLGALVWLILRAVNLILGIEGV 335

  Fly   322 ---SRQSR-------HQMIPNT-----LVNLCAFRAILGLPFPETRRTSLSLRQLFLA-IALFGM 370
               ||.:|       .::..:|     .||:..|.     ||...|        :|:| :.|..:
  Fly   336 PDGSRATRISYFGAARRIFVDTWVIWVRVNVGRFP-----PFHSER--------IFVASLCLVSV 387

  Fly   371 IFSIFINCKLSSMLTNPCPRPQVNNFEELKTSGLTVVMDHDAENFIEKEIGVDFF---NQYMPRK 432
            ||...:...|:::...|.....||...||..||..:.:.|.|  |.:     |.|   |..:.|:
  Fly   388 IFGALLESSLATVYIRPLYYRDVNTLRELDESGQPIYIKHPA--FKD-----DLFYGHNSEVYRR 445

  Fly   433 VTLTFTERAKLLFSLKGNHAFTLFSESFAIIESYQRSKGLRAHCTSEDL-------IVAERVPRI 490
            :.      ||::...:|..         .:||...:..|......|..|       ::.::|.:|
  Fly   446 LD------AKMMLVAEGEE---------RLIEMVSKRGGFAGVTRSASLQLSDIRYVMTKKVHKI 495

  Fly   491 ----------YILENNSILDRPLRRFIRQMQESGITNHW-----------LKNIPSSLEKNLMQI 534
                      |:|...|.....:.|.:.::...||...|           ::..|..|.:     
  Fly   496 PECPKNYHIAYVLPRPSPYLEEVNRIVLRLVAGGIVGLWTGEAKERAKWSIQRFPEYLAE----- 555

  Fly   535 TIPYDRERVHPLSIEHLTWLWCILILGYSISMIVFFVEMSLKRRKK 580
               .|..|...|::..:...:..|.:|..:|.||...|:.|.|:::
  Fly   556 ---LDVGRWKVLTLSDVQLAFYALTIGCLLSAIVCMAEILLGRQRR 598

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ir94bNP_732700.2 None
Ir100aNP_651898.2 Periplasmic_Binding_Protein_Type_2 210..>255 CDD:304360 8/45 (18%)
Lig_chan <439..580 CDD:278489 26/164 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.