DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ir94b and Ir94e

Sequence 1:NP_732700.2 Gene:Ir94b FlyBaseID:FBgn0051424 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_001097885.2 Gene:Ir94e FlyBaseID:FBgn0259194 Length:611 Species:Drosophila melanogaster

Alignment Length:638 Identity:123/639 (19%)
Similarity:232/639 (36%) Gaps:148/639 (23%)


  Fly    42 METLVIVKHHLD---------NNCSL--QNWNAHGM----------GIIRTNDQGKLIMKDTFNS 85
            :|.|..:|..||         .|.||  |.||...:          .:::.|:.....:.::.:.
  Fly    23 IELLGTLKLELDFEYVLLMKNRNFSLSDQVWNGTSLTKDVMDEVQVPVLQFNENVSYFLHNSISR 87

  Fly    86 RTLAIICIG------QNSHITLLRNVFETFGKVQQKKIILWTQMELKEKFFQEISKKSRDLKLLN 144
            |   ::.:|      .:.|..||..:......:...::|...|.:....|..|:.:.....||||
  Fly    88 R---LVTLGFMSDANLDEHRGLLTALVANLRHMTTSRVIFLVQSKASTDFLYELFRNCWRKKLLN 149

  Fly   145 LLVLKAVTKDKLLIYRLNPFPSPHFKRIENIW-TPNDTL--FMDTKFNFHG-------------M 193
            ::|:....:.....|..:.||....:  |.|: |...||  |.|...|.||             |
  Fly   150 VIVIFQDFETTSTFYSYSNFPILQIE--ERIYETSLQTLPIFPDRLRNLHGYEMPVILGGTAPRM 212

  Fly   194 TA-------VVKHDYNWTI--------QMGNIRKFPISRIEDKEVIEFALKYNLTLQFFNDVERF 243
            .|       ||   |:.|:        |..|: || :..::.|..::||    .::|....|...
  Fly   213 IAYRNKKGNVV---YDGTVGHFMTAFQQKYNV-KF-VQPLQAKNPLDFA----PSMQTVGAVRNE 268

  Fly   244 DIELRKRIILKSNSTQPIDSGIPMVFSSLLIVVPCGNYLSIQDVIKVSGIEKWIFYI-ILVYVIF 307
            .:|:  .|.|...:..|.....|....:..:::|.           .:.:..:.:|. :.....|
  Fly   269 TVEI--SISLTFPTIPPFGFSYPYEQMNWCVMLPV-----------EADVPPFEYYTRVFELAAF 320

  Fly   308 VLIEITFLGVTILI-----SRQSRHQMIPNT---LVNLCAFRAILGLPFPETRRTSLSLRQLFLA 364
            :|.    ||..:||     |..|.|....|.   |::....|.:||..|.|..|....:|.::|.
  Fly   321 LLT----LGTLVLISCLLASALSLHGYATNISEFLLHDSCLRGVLGQSFVEVFRAPTLVRGIYLE 381

  Fly   365 IALFGMIFSIFINCKLSSMLTNPCPRPQVNNFEELKTSGLTVV----------------MDHDAE 413
            |.:.|::.:.:.|...||.:|:...:|....::::..|.|.||                ..::..
  Fly   382 ICVLGILITAWYNSYFSSYVTSAPKQPPFRTYDDILASKLKVVAWKPEYAELVGRLLEFRKYETM 446

  Fly   414 NFIEKEIGVDFFNQYMPRKVTLTFTERAKLLFSLKGNHAFTLFSESFAIIESYQRSKGLRAHCTS 478
            ..:|.:     ||:|:..:.|            |...:.:.:.:..:.:|...|:..........
  Fly   447 FLVEPD-----FNRYLALRDT------------LDTRYGYMITTNRWVLINEQQKVFSRPLFQKR 494

  Fly   479 EDLIVAERVPRIYILENNSILDRPLRRFIRQMQESGITNHWLKNIPSSL----EKNLMQITIPYD 539
            :|......:|..:.|..||:...|:::.|.::.|:|:..||:....|.|    |.:.:.:: |:.
  Fly   495 DDFCFFNNIPFGFPLHENSVFMEPVQKLIMELAETGLYYHWITTGFSELIDAGEMHFVDLS-PHR 558

  Fly   540 RERVHPLSIEHLTW------------LWCILILGYSISMIVFFVEMSLKRRKK 580
            ..|...:......|            :|.:..|.|::.....|....::|.||
  Fly   559 EFRAMQIQDLQYVWYGYAFMVVLSSLVWLLENLAYTVKSKTIFPTHFMQRNKK 611



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.