DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir94b and Ir92a

DIOPT Version :9

Sequence 1:NP_732700.2 Gene:Ir94b / 318728 FlyBaseID:FBgn0051424 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_001097845.2 Gene:Ir92a / 42415 FlyBaseID:FBgn0038789 Length:678 Species:Drosophila melanogaster


Alignment Length:350 Identity:60/350 - (17%)
Similarity:119/350 - (34%) Gaps:87/350 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 PIDSGIPMVFSSLLIVVPCGNYLSIQDVIKVSGIEKWIFYIILVYVIFVLIEITFLGVTILISRQ 324
            |.::...:|..|.|::  ||.:                    |.::.:|...:.:.|..:.....
  Fly   379 PFNNRAWLVLISTLVI--CGTF--------------------LYFMKYVSYRLRYSGTQVKFHHS 421

  Fly   325 SRHQMIPNTLVNLCAFRAILGLPFPETRRTSLSL----RQLFLAIALFGMI-FSIFINCKLSSML 384
            .:   :..:::::.|.       |.:.....||.    .:.|||..|...| .....:.:|.|||
  Fly   422 RK---LEKSMLDIFAL-------FIQQPSAPLSFDRFAPRFFLATILCATITLENIYSGQLKSML 476

  Fly   385 TNPCPRPQVNNFEELKTSGL-----TVVMDH-------DAENFIEKEIGVDFFN-----QYMPRK 432
            |.|.....|:..|:...||.     :::..|       :.|..:.:...|..::     .:||  
  Fly   477 TFPFYSAPVDTIEKWAQSGWKWSAPSIIWVHTVQSSDLETEQILARNFEVHDYSYLSNVSFMP-- 539

  Fly   433 VTLTFTERAKLLFSLKGNHAFTL--FSESFAIIESYQRSKGLRAHCTSEDLIVAERVPRIYILEN 495
                             |:.|.:  .|.....:..|..::.|.......|.:..:....:.|  .
  Fly   540 -----------------NYGFGIERLSSGSLSVGDYVSTEALENRIVLHDDLYFDYTRAVSI--R 585

  Fly   496 NSILDRPLRRFIRQMQESGITNHW-LKNIPSSLEKNLMQITIPYDRERVH-------PLSIEHLT 552
            ..||...|.:.||..||:|:..|| |:.|...::|...::.:  |....|       .|.:.::.
  Fly   586 GWILMPELNKHIRTCQETGLYFHWELEFIDKYMDKKKQEVLM--DLANGHKVKGAPQALDVRNIA 648

  Fly   553 WLWCILILGYSISMIVFFVEMSLKR 577
            ....:|..|.:.:......|:.:.|
  Fly   649 GALFVLAFGVAFAGCALVAELLIHR 673



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.