DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir94b and Ir85a

DIOPT Version :8

Sequence 1:NP_732700.2 Gene:Ir94b / 318728 FlyBaseID:FBgn0051424 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_649833.1 Gene:Ir85a / 41052 FlyBaseID:FBgn0037630 Length:605 Species:Drosophila melanogaster

Alignment Length:643 Identity:127/644 (20%)
Similarity:234/644 (36%) Gaps:147/644 (23%)


  Fly     7 LLFILILSQAVSQETEF-LQLKYLNNIVRSMIKLHKMETLV------IVKHHLDN---------- 54
            ||..::::.|.::|... |.||      :|.|.:.||..::      ::..:.:|          
  Fly    10 LLLAILVNLAGTRENHIPLDLK------KSSIVMVKMSQILCKARIKVLFVYFENQTSHEHTGQI 68

  Fly    55 -----NCSLQNWNAHGMGIIRTNDQGKL---IMKDTFNSRTLAIICIGQ------NSHITLLRNV 105
                 .|.:.|.|.   .:....|.|.|   :|..|..|:.|.:..|.:      .||:.||...
  Fly    69 LKEVTKCDISNQNT---PLEAVKDDGILMYMVMITTNISQPLELSLIRKKSAAKHRSHVFLLVRD 130

  Fly   106 FETFGKVQQKKIILWTQMELKEKFFQEISKKSRDLKLLNLLVLKAVTKD-KLLIYRLNPFPSPHF 169
            .:|....       |.:...:: |::        :.|||:::|  ..:| :|..||.|||...:.
  Fly   131 ADTVSDA-------WMRASFRQ-FWK--------IWLLNIVIL--YWRDGRLNAYRYNPFMDNYL 177

  Fly   170 KRIENIWTPNDT-----LFMDTKFNFHG---MTAVVKHDYN---W---TI--QMGNIRKFPISRI 218
            ..::|  .||:.     ||..|..|...   ...:.|.|..   |   ||  ..|.:..:...|:
  Fly   178 IPVDN--KPNEVPTLEQLFPKTIPNMQRKPLRMCIYKDDVRAIFWRQGTILGTDGLLAAYVAERL 240

  Fly   219 EDKEVIEFALKYNLTLQFFNDV-------ERFDIELRKRIILKSNSTQPIDSGIPMVFSSLLIVV 276
            ....:|.....|| .....:|:       |..|:.:..|.::.....:..:|.:......|.::|
  Fly   241 NATMMITRPHSYN-NHNLSSDICFLEVAKEYVDVAMNIRFLVPDTFRKQAESTVSHTRDDLCVIV 304

  Fly   277 PCGNYL-SIQDVIKVSGIEKWIFYIILVYVIFVLIEITFLGVTILISRQSRHQMIPNTLVNLCAF 340
            |..... :..::.:..|...|...::.|.|..|.       ..||.|...|   :|..|     |
  Fly   305 PKAKTAPTFWNIFRSFGSLVWALILVSVLVANVF-------CYILKSEVGR---VPMQL-----F 354

  Fly   341 RAILGLPFPETRRTSLSLRQLFLAIAL-FGMIFSIFINCKLSSMLTNPCPRPQVNNFEELKTSGL 404
            ...|.:|..:. ..:.|:| |||...| ||::........|:||:......|.:|....|..|..
  Fly   355 AGALTMPMTQI-PPNHSIR-LFLIFWLYFGLLICSAFKGNLTSMMVFQPYLPDINQLGALARSHY 417

  Fly   405 TVVMDHDAENFIEKEIGVDFFNQYMPRKVTLTFTERAKLLFSLKGNHAFTLFSESFAIIESYQRS 469
            .:::.......|:..:.:...::...|:..|..::..  ::.:..|:..     .||.:|.|..:
  Fly   418 HIIIRPRHVKHIQHFLTLGHKHESRIREQMLEVSDTQ--MYEMMRNNDI-----RFAYLEKYHIA 475

  Fly   470 K---GLRAH-------------CTSEDLIVAERVP--RIYILENNSILDRPLRRFIRQMQESGIT 516
            :   ..|.|             |.         ||  .:||:...|.....|...||...|.|..
  Fly   476 RFQVNSRVHMHLGRPLFHLMNSCL---------VPFHAVYIVPYGSPYLGFLDSLIRSSHEFGFE 531

  Fly   517 NHWLKNIPSSLEKNLMQITIPYDRER----VHP--LSIEHLTWLWCILILGYSISMIV 568
            .:|.:.:.|:..|:.:::.   :|.|    ..|  |.::|...::.:.::|..::.||
  Fly   532 RYWDRIMNSAFIKSGVKVV---NRRRGSGNDEPVVLKLQHFHAVFALWLVGIGMACIV 586



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.