DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ir94b and Ir76a

Sequence 1:NP_732700.2 Gene:Ir94b FlyBaseID:FBgn0051424 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_001097647.3 Gene:Ir76a FlyBaseID:FBgn0260874 Length:646 Species:Drosophila melanogaster

Alignment Length:713 Identity:132/714 (18%)
Similarity:236/714 (33%) Gaps:224/714 (31%)


  Fly    10 ILILSQAVSQETEFLQLKYLNNIVRSMIKLH-----KMET-----LVIVKHHLDNNCSLQNWNAH 64
            :|:.|...|....|...::..:...:.|..|     ::||     |:|:..|...|.|.|  :.:
  Fly     4 LLVESYYFSTVLSFFAQQFFADSHATCIFWHPAFDFRLETVHPMPLIIMDWHRWANRSDQ--DVY 66

  Fly    65 GMGIIRTNDQGKLIMKDTFNSRTLAIICIGQNSHITLLRNVFETFGKVQQK------------KI 117
            ...|.....:||.|   .:|..||.:....:.||.       |||...|::            ..
  Fly    67 DYKIKEDEFEGKGI---PYNDWTLRLTVAIERSHC-------ETFIAFQEQIPEFARYFYHASIY 121

  Fly   118 ILWTQMELKEKFFQEISKKSRDLK-----------LLNLLVLKA-VTKDKLLIYRLNPFPSP-HF 169
            .:|  ..|:.:|....:|:..|.|           ..|:||:.: .........:.|.|..| :|
  Fly   122 SIW--RSLRNRFMFVYTKEFEDKKDSYLSGYIFQDQPNILVITSQYLNSSTFEIKTNRFVGPRNF 184

  Fly   170 KRIENIWTPNDT-LFMDTKFNFHGMTAVVKHDYNWTIQMGNIRKFPISRIEDKEVIEFALKYNLT 233
            .:     .|... .::..:|:..|..|      .|..|.....|  :..::.:||:.....|...
  Fly   185 NK-----NPEPVEFYILQRFDAKGTKA------TWETQSAMSSK--MRNLKGREVVIGIFDYKPF 236

  Fly   234 L------------QFFN----DVERFDIELRKRIILKSNSTQPIDSGIPMVFSSLLIVVP----C 278
            :            :|.|    .::..||:|........|.|..:|:..|..:..:.:...    .
  Fly   237 MLLDYEKPPLYYDRFMNTTDVTIDGTDIQLMLIFCELYNCTIQVDTSEPYDWGDIYLNASGYGLV 301

  Fly   279 GNYLSIQDVIKVSGIEKWIFYIILVYVIFVLIEIT-FL---GVTILISRQSRHQMIPNTLVN--- 336
            |..|..::...|.|:..|       |..:..:::| ||   |||.|:.       .||.|::   
  Fly   302 GMILDRRNDYGVGGMYLW-------YEAYEYMDMTHFLGRSGVTCLVP-------APNRLISWTL 352

  Fly   337 ----------LCAFRAIL--GLPFPETRR------------------------------------ 353
                      :|....:|  .|....|||                                    
  Fly   353 LLRPFQFVLWMCVMLCLLLESLALGITRRWEHSSVAAGNSWISSLRFGCISTLKLFVNQSTNYVT 417

  Fly   354 TSLSLRQLFLAIALFGMIFSIFINCKLSSMLTNPCPRPQVNNFEEL----------KTSGLTVVM 408
            :|.:||.:.:|..:..:|.:...:..|:::||.|......::.:.|          ..:.:|.:.
  Fly   418 SSYALRTVLVASYMIDIILTTVYSGGLAAILTLPTLEEAADSRQRLFDHKLIWTGTSQAWITTID 482

  Fly   409 DHDAENFIEKEIG-VDFFNQYMPRKVT-LTFTER-----AKLLFSLKGNHAFTLFSESFAIIESY 466
            :..|:..:   :| ::.:..|....:: .:.||:     .:|.|...||   |...|:.|:    
  Fly   483 ERSADPVL---LGLMEHYRVYDANLISAFSHTEQMGFVVERLQFGHLGN---TELIENDAL---- 537

  Fly   467 QRSKGLRAHCTSEDLIVA---ERVPRIYILENNSILDRPLRRFIRQMQESGITNHW--------- 519
                 .|.....:|:..|   ..|||:: ...|:..|     ||.....||....|         
  Fly   538 -----KRLKLMVDDIYFAFTVAFVPRLW-PHLNAYND-----FILAWHSSGFDKFWEWKIAAEYM 591

  Fly   520 ----LKNIPSSLEKNLMQITIPYDRERVHP--LSIEH---LTWLWCILILGYSISMIVFFVEM 573
                ...|.:|.:.||          .:.|  |.|::   |..|||   .|...|::.|..|:
  Fly   592 NAHRQNRIVASEKTNL----------DIGPVKLGIDNFIGLILLWC---FGMICSLLTFLGEL 641



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.