DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ir94b and Ir68b

Sequence 1:NP_732700.2 Gene:Ir94b FlyBaseID:FBgn0051424 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_648548.1 Gene:Ir68b FlyBaseID:FBgn0036250 Length:635 Species:Drosophila melanogaster

Alignment Length:635 Identity:120/636 (19%)
Similarity:210/636 (33%) Gaps:198/636 (31%)


  Fly    91 ICIGQNSHITLLRNV---------------FETFGKVQQKKIILWTQMELKEKFFQEISKKSRDL 140
            |.:.||..:|.|...               .:.:..|..:..::...||..|      .:..|..
  Fly    26 IAVEQNVQVTYLYRCASCPASFDADYSALELDLYRCVGSRLPVITRNMEAHE------LEPFRRT 84

  Fly   141 KLLNLLVLKAVTKDKLLIYRLNPFPSPHFKRIEN-----IWTPND------TLFMDT--KFNFHG 192
            ..|::..:.|..|...|:.|:....:||.:|...     :| ||.      .||..:  |...:|
  Fly    85 DSLSIFQIPAAEKGDSLVRRILDMLNPHQRRKHMHKYLFVW-PNAGRHQLLRLFRGSWAKKLLYG 148

  Fly   193 MTAVVKHD-------YNWTIQMGNIRKFPISRIEDKEVIEFALK------YNLTLQFFND----V 240
            :....:.:       :.|    |.::  .|.|::.:  :.:|.|      |.|....|.|    :
  Fly   149 LAITGRENGTFDFDPFAW----GGLQ--VIQRLDGE--VPYARKVKDLRGYPLRFSMFTDPLMAM 205

  Fly   241 ERFDIE---------LRKRIILKSNSTQPIDSGIPMVF----SSLLIVVPCGNYLSIQD------ 286
            .|..:|         :..|::     .:.:::.:..||    .|....:|.|||..:..      
  Fly   206 PRSPVETAGYQAVDGVAARVV-----GEMLNASVTYVFPEDNESYGRCLPNGNYTGVVSDIVGGH 265

  Fly   287 -------------------------------VIKVSGIEKWIFYIILVYV----IFVLIEITFLG 316
                                           |:..|.|:.  .|:|.|.|    ::.|:.:|.|.
  Fly   266 THFAPNSRFVLDCIWPAVEVLYPYTRRNLHLVVPASAIQP--EYLIFVRVFRRTVWYLLLVTLLV 328

  Fly   317 VTILISRQSRHQ-MIPNTLVNLCAFRA----ILGLPF-------PETRRTSL-SLRQLFLAIALF 368
            |.::.....|.| .||..  .:..|:|    ||.: |       |..|.:|. |:|...:...||
  Fly   329 VVLVFWVMQRLQRRIPRR--GVIQFQATWYEILEM-FGKTHVGEPAGRLSSFSSMRTFLMGWILF 390

  Fly   369 GMIFSIFINCKLSSMLTNPCPRPQVNNFEEL-----KTSGLTVVMDHDAENFIEKEIG-VDFFNQ 427
            ..:.|.....||.|....|....||:..::|     ....:|.:.|.......|.:.| ::..::
  Fly   391 SYVLSTIYFAKLESGFVRPSYEEQVDRVDDLVHLDVHIYAVTTMYDAVRSALTEHQYGLLENRSR 455

  Fly   428 YMPRKVTLTFTERA------KLLFSLKGNH-----AFTLFSE----SFAIIESYQRSKGLRAHCT 477
            .:|..:..::.:..      :..|.::..|     |.|..|:    ::.|...|.||    ..||
  Fly   456 QLPLGIATSYYQPVVRRRDRRAAFIMRDFHARDFLAITYDSQAERPAYHIAREYLRS----MICT 516

  Fly   478 SEDLIVAERVPRIYILENNSILDRPLRRFIRQMQESGITNHW-----LKNIPSS--LEKNLMQIT 535
                         |||...|.....|........|.|...||     :..:.:|  .|:.|..:.
  Fly   517 -------------YILPRGSPFLHRLESLYSGFLEHGFFEHWRQMDLITRVGASPDAEEFLEDLG 568

  Fly   536 IPYD----------RERVHPLSIEHLT---WLWCILILGYSISMIVFFVE 572
            ...|          |.:...|:::.|.   :||.:   |..||.:.|.||
  Fly   569 DQTDTDSGSNELAIRNKKVVLTLDILQGAFYLWSV---GIGISCLGFAVE 615

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ir94bNP_732700.2 None
Ir68bNP_648548.1 Lig_chan 333..607 CDD:278489 59/297 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.