DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ir94b and Ir62a

Sequence 1:NP_732700.2 Gene:Ir94b FlyBaseID:FBgn0051424 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_001033986.1 Gene:Ir62a FlyBaseID:FBgn0053971 Length:606 Species:Drosophila melanogaster

Alignment Length:702 Identity:139/703 (20%)
Similarity:251/703 (36%) Gaps:215/703 (31%)


  Fly     3 LIFNLLFILILS--QAVSQET---EFLQLKYLNNIVRSMIKLHKMETLVIVK-------HHLDN- 54
            :....||.|.||  |.|:.|.   .|....:|:.|.|    :|::..:.||.       .:||: 
  Fly     1 MYLQFLFALFLSRYQIVATENFDRAFELALFLDRIGR----VHRLHAITIVNSLGSVDPSYLDDL 61

  Fly    55 ----NCSLQNWNAHGMGIIRTNDQGKLIMKDTFNSRTLAIICIGQNSHITLLRN---VFETFGKV 112
                .|:..| :.:.:..:...|      ||:            .:.|.:.|::   ::..|.: 
  Fly    62 HRGLMCNSSN-HFYMLPQMTATD------KDS------------SHVHFSSLQDEETIYLVFAR- 106

  Fly   113 QQKKIILWTQME-------LKEKFFQEISKKSRDLKLLNLLVLKAVTKDKLLI------YRLNPF 164
            ..|..:::.|.|       .:..|.....:..:|:|....|:.|...:..|::      |:::|:
  Fly   107 DSKDAVIYLQAERARGRRYTRTMFLLRKQESQKDIKYFFELLWKLQFRSALVVVAARNFYQMDPY 171

  Fly   165 PSPHFKRIENI--WTPNDTLFMDTKFNFHG--MTAVVKHDYNWTIQMGNIR--KFPISRIEDKEV 223
            |:....|:..:  :.|:.......:.||.|  |...|:.|...|....|.|  .:.::.:....:
  Fly   172 PTVRVIRMRRLSSYDPHHVFPPANRKNFRGYRMRLPVQQDVPNTFWYKNRRTKAWELAGLGGILI 236

  Fly   224 IEFALKYNLTLQFFNDVERFD--------------------IELRKRI--ILKSNSTQPIDSGIP 266
            .:..:..|:|:..|    ||:                    :||...:  .|:||::  :|...|
  Fly   237 NQLMMHLNVTMDLF----RFEVNGSSLLNMAALTDLIVKGKVELSPHLYDTLQSNTS--VDYSYP 295

  Fly   267 MVFSSLLIVVPCGNYLSIQDVIKVSGIEKWIFYIILVY-------VIFVLIEITFLGVTILISRQ 324
            ...:....::|..|.:|..            .|:.|.:       ::|||:.:.|:.|       
  Fly   296 TQVAPRCFMIPLDNEISRS------------LYVFLPFSLTMWLCLLFVLLVVHFVYV------- 341

  Fly   325 SRHQMIPNTLVNLCAFRAILGLPFPETRRTSLSLRQLFLAIALFGMIFSIFI-----NCKLSSML 384
              .::||:.     .|.||||:  |...:.....|:.....:.|.::|.|||     :.||:|.|
  Fly   342 --RRLIPDG-----HFWAILGV--PGAGQVRYGNRKPVRRFSTFLILFGIFILGQTYSTKLTSSL 397

  Fly   385 TNPCPRPQVNNFEE----------LKTSGLTVV--MDH-----------DAENFIEKEIGVD--- 423
            |....|...|:.||          |.|....:|  :.|           |||||.:|.|.:.   
  Fly   398 TVTLIRRPDNSLEELFLLPYRILVLPTDVYAIVDSLGHAEQFSTKFSCTDAENFSQKRISMHPEY 462

  Fly   424 ----------FFNQYMPRKVTLTFTERAKLLFSLKGNHAFTLFSESFAIIESYQRSKGLRAHCTS 478
                      ||:...      .|..:.:..||...:.:|                         
  Fly   463 IYPISTIRWRFFDMQQ------RFLRKKRFYFSKICHGSF------------------------- 496

  Fly   479 EDLIVAERVPRIYILENNSILDRPLRRFIRQMQESGITNHWL-----KNIPSSLEKNLMQITIPY 538
                     |..|.|..:|.|...|.||:..:|::|:.:.||     |.......|:...:....
  Fly   497 ---------PYQYQLRVDSHLKDALHRFLLHVQQAGLHDLWLDTCYRKAHRMGYLKDFSTLAELE 552

  Fly   539 DRERVHPLSIEHLTWLWCILILGYSISMIVFFVEMSLK---RRKKNLENRAP 587
            ::.|:.||::..|...:.:.:.|...|.|.|.||:...   |:|....||.|
  Fly   553 EKLRLRPLALNLLVPAFSLFLCGMLGSGIAFLVEIRHSFGCRQKPPSINRNP 604



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.