DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ir94b and Ir56d

Sequence 1:NP_732700.2 Gene:Ir94b FlyBaseID:FBgn0051424 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_611432.1 Gene:Ir56d FlyBaseID:FBgn0034458 Length:632 Species:Drosophila melanogaster

Alignment Length:667 Identity:123/668 (18%)
Similarity:231/668 (35%) Gaps:171/668 (26%)


  Fly     4 IFNLLFILILSQAVSQETEFLQLKY-------LNNIVRSMIKLHKMET-------LVIVK-HHLD 53
            :.|.:|:|.:...::|...|....:       ||| ..|....|...|       |:|.: ||| 
  Fly    26 LLNNMFVLEMFYRITQLYHFKNFIFYISERLDLNN-KDSQEFFHNFWTYFPMAPNLIITREHHL- 88

  Fly    54 NNCSLQNWNAHGMGIIRTNDQGKLIMKDTFNSRTLAIICIGQNSH-ITLLRNVFETFGKVQQKKI 117
                       |:.:::......|:|..|.......:.....|.. |..|:.:|..|..:|.:. 
  Fly    89 -----------GIPMMQFISTPSLVMVFTTGKDDPIMELASHNQQGIHWLKTIFVLFPSLQSRD- 141

  Fly   118 ILWTQMELKEKFFQEISKKSRDL-------KLLNLLVLKAVTKDKLLIYRLNPFPSPHFKRIENI 175
             ..|..|...:|..||    :|:       :.:|..::  ..||.:.|  |:|:|:|.......:
  Fly   142 -FETNPESLAQFTAEI----KDVYDWVWRKQFINTFLI--TIKDNVFI--LDPYPTPSIVNKTGV 197

  Fly   176 WTPNDTLFMDTKFNFHG----------MTAVVKHDYNWTIQMGNIRKFPISRIEDKEV------- 223
            |...:......| |..|          |..|.|.|.            |.:|.|...:       
  Fly   198 WQAEEFFHKYAK-NMKGYLVRTPILYDMPRVFKSDR------------PTNRYEKNFIHGTSGNL 249

  Fly   224 ----IEFA------LKYNLTLQFFNDVERFDI--------------ELRKRIILKSNSTQPIDSG 264
                :||.      ...|:|..:.|.....|:              |:..:.:        :...
  Fly   250 FLGFLEFVNATLMDTSANVTADYLNMTNLLDLVSQGVYETLIHSFTEITTKFV--------VSYS 306

  Fly   265 IPMVFSSLLIVVPCGNYLSIQDVIKVSGIEKWIFYIILVYVIFVLIEITFLGVTILISRQSRHQM 329
            .|:..:...|:||..|. |..|......:::.::.:|.::.:::.:.|      .|.|......:
  Fly   307 YPIGINDCCIMVPYRNQ-SPADQYMHEALQENVWVLISLFTLYITVAI------YLCSPLRPRDL 364

  Fly   330 IPNTLVNLCAFRAILGLPFPETRRTSLSLRQLFLAIALFGMIFSIFINCKLSSMLTNPCPRPQVN 394
            ....|.::|..  ...:|....|..:|.:|.|::.:|::|::.|.....:::|..|...|..|:|
  Fly   365 SAAFLQSICTL--TYSVPTFIIRTPTLRMRYLYILLAIWGIVTSNLYISRMTSYFTTAPPVRQIN 427

  Fly   395 NFEELKTSGLTVVMDHDAENFIEKEIGVDFFNQYMPRKVTLTFTERAKLLFSLKGNHAFTL---- 455
            ..:::..:.|.:           |.:.:::...   .|..|.:.|.......|...|...|    
  Fly   428 TVQDVVEANLRI-----------KMLAIEYERM---AKSPLQYPESYLNQVDLVDKHMLDLHRDP 478

  Fly   456 FSESFAIIESYQRSKGLRAHCTSEDLIVAERVPR-----------IYILENNSILDRPLRRFIRQ 509
            |:.||....|..|.:.|..    :.|.:.:.:.|           ::.|..:|.:...:..:|..
  Fly   479 FNTSFGYTVSSDRWRFLNL----QQLHLRKPIFRLTEICEGPFYHVFPLHKDSHMRSVMTEYIMI 539

  Fly   510 MQESGITNHWLKNIPSSLEKNLMQITIPYDRERVH-------PLSIEHLTWLWCILILGYSISMI 567
            .|::|:.|||        |:......:...|..||       .||::..:.|.....||..::.:
  Fly   540 AQQAGLMNHW--------ERETFWEAVHLHRIHVHLFDDEPMALSLDFFSSLLRTWTLGLILAGL 596

  Fly   568 VFFVEM------SLKRR 578
            .|..||      :.|||
  Fly   597 AFAAEMKWHEHVTFKRR 613

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ir94bNP_732700.2 None
Ir56dNP_611432.1 ATPase-IIIA_H <312..422 CDD:273731 22/119 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.