DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ir94b and Ir56c

Sequence 1:NP_732700.2 Gene:Ir94b FlyBaseID:FBgn0051424 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_611431.1 Gene:Ir56c FlyBaseID:FBgn0034457 Length:567 Species:Drosophila melanogaster

Alignment Length:599 Identity:108/600 (18%)
Similarity:216/600 (36%) Gaps:167/600 (28%)


  Fly   102 LRNVFETFGKVQQKKIILW-----TQMELKEKFFQEISK---KSRDLKLLN-----LLVLKAVTK 153
            |.|:...||::...:.|:|     .:::..::|...|.:   ||....::|     .::..:..:
  Fly     4 LLNLLAPFGRMNVFQEIVWFVSPHQRLDQLDEFIMRIDEAFGKSATQTVVNNNTEMRMIYSSARR 68

  Fly   154 DKLLIYRLNPFPSPHFKRIENI-----WTPNDTLFMDTKFNFHGMTAVVKHDYNWTI-------- 205
            :.:..........|..|....:     :..:..:::|...:.|.:..::...||...        
  Fly    69 NHMSFVFTTGAEDPIMKVFSKVLLGRHFYVSMVIYVDKVGDMHPIYDLLTFAYNQQFFNSMVHFE 133

  Fly   206 ------QMGNIRKFPISRIEDKEVIEFALKY--NLTLQFFN---DVERFDIELRKRIILKSNSTQ 259
                  |:..:.|||:...|::  .:| |||  .:..|..|   ||..|..            |.
  Fly   134 SMEGVNQLFGVSKFPVMSFENR--TDF-LKYMGKIWKQVQNARSDVGGFGF------------TT 183

  Fly   260 PIDSGIPMVFSSL------------------------LIVVP---CGNYLSIQDVIKV------- 290
            |:...:|.:|.|.                        ||:.|   .|..::::|.:::       
  Fly   184 PLRQDLPHLFQSQGHYDGSTYRIIETFVRFINGSFKELIMPPDSLGGQVINMKDALQLIRERKME 248

  Fly   291 ------------SGIEK---------------------------------WIFYIILVYVIFVLI 310
                        ..:||                                 | |:.:...:..||:
  Fly   249 FCAHAYALFMSDEELEKSYPLLVVQWCLMVPLYNSVSTYFYPLQPFDWNVW-FFALGALLALVLL 312

  Fly   311 EITFLGVTILISRQSRHQMIPNTLVNLCAFRAILGLPFPETRRTSLSLRQLFLAIALF-GMIFSI 374
            |:.:|.   :....|.::   ..::|  :|..|:.:|.....:....||.|.||...| |...|.
  Fly   313 ELMWLR---MFGGWSGYR---GAVLN--SFCYIINVPIEGQLQQPCLLRFLLLATVFFHGFFLSA 369

  Fly   375 FINCKLSSMLTNPCPRPQVNNFEELKTSGLTV-VMDHDAENF--IEKEIGVDFFNQYMPRKVTLT 436
            :....|.|:||......|:|...::.::.|.| ::|::.|..  :.||:..:|.....|.. :..
  Fly   370 YYTSNLGSILTVNLFHAQINTMNDIVSAQLPVMIIDYEMEFLLNLNKELPQEFLELLRPVD-SAV 433

  Fly   437 FTERAKLLFSLKGNHAFTLFSESFA--IIESY-----QRSKGLRAHCTSEDLIVAERVPRIYILE 494
            |:|..            |.|:.|||  :.|.:     ::.|.|:........|........:.|:
  Fly   434 FSEHQ------------TSFNSSFAYFVTEDHWEFLDEQQKHLKQRLFKLSSICFGSYHLAFPLQ 486

  Fly   495 NNSILDRPLRRFIRQMQESGITNHWLK-NIPSSLEKNLMQITIPYDRERVHPLSIEHLTWLWCIL 558
            .:|.|.|.:..|..::..||:.|.:.: :..|:|...|:| .:| |.:......::||...:.:|
  Fly   487 MDSSLWRDIEYFTFRIHSSGLLNFYARSSFGSALHAGLVQ-RMP-DTQEYTSAGLQHLAIAFILL 549

  Fly   559 ILGYSISMIVFFVE 572
            ::...::.|||.:|
  Fly   550 LVMSFLAGIVFVLE 563



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.