DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ir94b and Ir56b

Sequence 1:NP_732700.2 Gene:Ir94b FlyBaseID:FBgn0051424 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_611430.1 Gene:Ir56b FlyBaseID:FBgn0034456 Length:408 Species:Drosophila melanogaster

Alignment Length:456 Identity:95/457 (21%)
Similarity:176/457 (39%) Gaps:115/457 (25%)


  Fly   166 SPHFKRIENIWTPNDTLFMDTKFNFHGMTAVVKH---DYNWTIQMGNIRKFPISRIEDKEVIEFA 227
            ||:...|.:.:..|:|.|:..||....| .:|||   .|::.:.:.::...|...:.::::|  :
  Fly    14 SPYSFDIPHAFIFNETQFVVPKFCGPYM-EIVKHFAEVYHYQLFLDSLESLPKKSVVEQDII--S 75

  Fly   228 LKYNLTL-----------QFFNDVER-FDIELRKRIILKSNSTQPIDSGIPMVFSSLLIVVPCGN 280
            .||||:|           .|||..:. :.:||....::     .|:...:|   ..:.:|.|.|.
  Fly    76 GKYNLSLHGVIIRPEETSDFFNATQHSYPLELMTNCVM-----VPLAPELP---KWMYMVWPLGK 132

  Fly   281 YLSIQDVIKVSGIEKWIFYIILVYVIFVLIEITFL----GVTILISRQSRHQMIPNTLVNLCAFR 341
            |:             |....:..:.:.:|:.....    ..|...:|...|.|.      |..|.
  Fly   133 YI-------------WTCLFLGTFYVALLLRYVHWREPGNATRSYTRNVLHAMA------LLMFS 178

  Fly   342 AILGLPFPETRRTSLSLRQLFLAIALFGMIFSIF----INCKLSSMLT---NPCPRPQVNNFEEL 399
            |.:.:        |:.|:...:.:.:|..:..||    .|..||.|..   .|.....::.:.:|
  Fly   179 ANMNM--------SVKLKHASIRVIIFYTLLYIFGFILTNYHLSHMTAFDMKPVFLRPIDTWSDL 235

  Fly   400 KTSGLTVVMDHDAENFIEKEIGVDFFNQYMP----------RKVTLTFTERAKLLFSLKGNHAFT 454
            ..|.|.:|: ||:   :.:|:      :::|          |......|:.|.|.|:        
  Fly   236 IHSRLRIVI-HDS---LLEEL------RWLPVYQALLASPSRSYAYVVTQDAWLFFN-------- 282

  Fly   455 LFSESFAIIESY-QRSK----GLRAHCTSEDLIVAERVPRIYILENNSILDRPLRRFIRQMQESG 514
              .:...:|:.| ..||    ||           ...:|   :..|.|..| .|.:||..:.::|
  Fly   283 --RQQKVLIQPYFHLSKVCFGGL-----------FNALP---MASNASFAD-SLNKFILNVWQAG 330

  Fly   515 ITNHWLKNIPSSLEKNLMQITIPYDRERVHPLSIEHLTWLWCILILGYSISMIVFFVEMSLKRRK 579
            :.|:| :.:.....:......:..|...|.||::|..|..|.:|..|..||.:.|.:|:.:.|||
  Fly   331 LWNYW-EELAFRYAEQAGYAKVFLDTYPVEPLNLEFFTTAWIVLSAGIPISSLAFCLELFIHRRK 394

  Fly   580 K 580
            :
  Fly   395 Q 395



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.