DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ir94b and Ir54a

Sequence 1:NP_732700.2 Gene:Ir94b FlyBaseID:FBgn0051424 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_611259.2 Gene:Ir54a FlyBaseID:FBgn0034272 Length:586 Species:Drosophila melanogaster

Alignment Length:588 Identity:115/589 (20%)
Similarity:224/589 (38%) Gaps:150/589 (25%)


  Fly    80 KDTFNSRTLAIICIGQNS------------HITLLRN--------VFETFGK-----VQQKKIIL 119
            ||.|.::|:.::.:..:.            |:..|..        :.|.|..     ..||||:.
  Fly    49 KDIFENQTIPVVVLSDSETFINIRMFSRPLHVACLPGHELQKDLALLENFTSSLMDFPSQKKIVY 113

  Fly   120 W-------TQMELKEKFFQEISKKSRDLKLLNLLVLKAVTKDKLLIYRLNPFPS--PHFKRIENI 175
            .       |:|:    :..|.....|...::.||    .:.:....||.:.:||  ..::.:|  
  Fly   114 ISNNFSDPTRMD----YIFETCYHRRIWNIVGLL----ASDEHRYFYRYHLYPSFRTEYRSLE-- 168

  Fly   176 WTPNDTLFMDTKF-NFHGMTAVVKHDYNWTIQMGNIRKFP-----ISRIEDKEVIE--------- 225
               :.|:| |..| |.||....|..| .|         .|     :.|...|:::.         
  Fly   169 ---SSTIF-DKDFPNMHGHPLTVMPD-QW---------LPRSVLYVDRRTGKQILAGSVGRFFHV 219

  Fly   226 FALKYNLTLQFFNDV---------------ERFDIELRKRIILKSNSTQPIDSGIPMVFSSLLIV 275
            .:.|.|.|||....|               |.|.:::...:.:.....|...:..||..:.:.::
  Fly   220 LSWKLNATLQLSKKVTTGRFLNATALKELSESFSVDVPASLTIMERVEQLASTSYPMEVTHVCLM 284

  Fly   276 VPCGNYLSIQDVIKVSGIEKWIFYIIL-----VYVIFVLIEITFLGVTILISRQSRHQMIPNTLV 335
            ||....:.|:|:           |.||     :::..|::....|.:.:|.:...|...:.:.::
  Fly   285 VPVARRIPIKDI-----------YFILSSASNMFLAIVIVSSYGLALNLLRNMTHRDVRLVDFVL 338

  Fly   336 NLCAFRAILGLPFPETRRTSLSLRQLFLAIALFGMIFSIFINCKLSSMLTNPCPRPQVNNFEELK 400
            |..|.|.|||..|......|.|.|.:||.:.:.|:..|......|.:::.:|..:.|..:|..|:
  Fly   339 NDKALRGILGQSFNLPLSRSFSTRLIFLMLGIVGLNVSSIFGAGLDTLMAHPPRQFQARSFAGLR 403

  Fly   401 TSGLTVV-MDHDAENFIEKE-----IGVDFFNQYMPRKVTLTFTERAKLLFSLKGNHAFTLFSES 459
            .:.:.:| .:.|...:::..     :.|..:|.....:.|......::|.::        |||| 
  Fly   404 RTKIPLVTTEEDFPTWMKLRVPMLVVNVSEYNHLRNGRNTSNAYFASRLYWN--------LFSE- 459

  Fly   460 FAIIESYQRSKGLRAHCTSEDL----IVAERVPRIYILENNSILDRPLRRFIRQMQESGITNHWL 520
                :..:.::.|..:.|.:.|    :::.:.|:      ||:...|:.:.|.::..:|:.:.|:
  Fly   460 ----QQKRFTRELFIYSTDDCLWSLALLSFQWPQ------NSLFTEPVSQLILEVNANGLYDFWV 514

  Fly   521 ---------KNIPSSLEKNLMQITIPYDRERVHP--LSIEHLTWLWCILILGYSISMIVFFVEMS 574
                     ..: |.||...:|:     :||.||  |.|....|:|........|:::||.:|:|
  Fly   515 GMHYYDMTAAGL-SGLEDPSLQL-----KEREHPTSLRIVDFQWMWQAYGTFMVIAILVFLLEVS 573

  Fly   575 LKR 577
            ..|
  Fly   574 WHR 576



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.