DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ir94b and Ir52d

Sequence 1:NP_732700.2 Gene:Ir94b FlyBaseID:FBgn0051424 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_611042.2 Gene:Ir52d FlyBaseID:FBgn0050464 Length:594 Species:Drosophila melanogaster

Alignment Length:626 Identity:111/627 (18%)
Similarity:205/627 (33%) Gaps:194/627 (31%)


  Fly     6 NLLFILILSQAVSQETEFLQLKYLNNIVRSMIKLH---KMETLVIVKHHLDN-NCSLQNWNAHGM 66
            :|..||.......:|..:..||.| .:.|.:|.|:   |.:::.......|. |.::.|.|.|.:
  Fly    85 SLALILTCEFKAEREENYQTLKKL-QMNRRLILLNGNIKPDSVCDFYSKKDQYNIAMVNNNFHQV 148

  Fly    67 GIIRT--------------------------NDQGKLIMKDTFN----SRTLAIICIGQNSHITL 101
            |||..                          |.||.|:...|||    |........||..||..
  Fly   149 GIIYACRLFQERNYEKVYLSEGNPIYVDQFRNMQGALLKSITFNLIPGSMAYRDPKTGQEKHIGY 213

  Fly   102 LRNVFETFGKVQQKKIILWTQMELKEKFFQEISKKSRDLKLLNLLVLKAVTKDKLLIYRLNPFPS 166
            :.|:...|                                                         
  Fly   214 VANLLNNF--------------------------------------------------------- 221

  Fly   167 PHFKRIENIWTPNDTLFMDTKFNFHGMTAVVKHDYNWTIQMGNIRKFPISRIEDKEVIEFALKYN 231
                 :|.:   |.||.|..|.:..|.....   ||            |::...:::::..:.|.
  Fly   222 -----VEKV---NATLDMQVKLHKAGKKTSF---YN------------ITKWASEDLVDIGMSYA 263

  Fly   232 LTLQFFNDVERFDIELRKRIILKSNSTQPIDSGIPMVFSSLLIVVPCGN-------YLSIQD--V 287
            ...:..|    ||                 ....|.:.:|...:||..:       |:.|.|  |
  Fly   264 AYFEMTN----FD-----------------TISYPYLMTSTCFMVPLPDMMPNSEIYMGIVDPPV 307

  Fly   288 IKVSGIEKWIFYIILVYVIFVLIEITFLGVTILISRQSRHQMIPNTLVNLCAFRAILGLPFPETR 352
            :.|         :|.::.||.::      :..:..|..|...:.|.|:|....|..|..|||..|
  Fly   308 LVV---------LIAIFCIFSVM------LNYIKQRSWRSLSLVNVLLNDICLRGFLAQPFPFPR 357

  Fly   353 RTSLSLRQLFLAIALFGMIFSIFINCKLSSMLTNPCPRPQVNNFEELKTSGLTV-VMDHDAENFI 416
            :::..|:.:.:.:..|.:|.:......|.|.:..|...|::.:|.:|:.|...: :..:|.|...
  Fly   358 QSNRKLKLISMLVCFFSVITTTMYTSYLQSFMWGPPIDPKMCSFADLENSRYKLAIRRYDIEMLR 422

  Fly   417 EKEIGVDFFNQYMPRKVTLTFTERAKLLF---SLKGNHAFTLFSESFAIIESYQRSKGLRAHCTS 478
            ...:.:|.         .:.|.|.::|.:   |...|:.:.:.:.|::..:..|:.........|
  Fly   423 PFNVSMDH---------VVVFDESSQLEYLRDSFDDNYMYPMSALSWSAFKEQQKLFAFPLFYYS 478

  Fly   479 EDLIVAERVPRIYILENNSILDRPLRRFI----------RQMQESGITNHWLKNIPSSLEKNLMQ 533
            |.|          .|:..|....|:||.:          .|..|.|::.:|:....|.:.:..:.
  Fly   479 EKL----------CLKPISFFSFPIRRHLPYRDLFEEHMLQQNEFGLSTYWIDRSFSDMVRLKLA 533

  Fly   534 ITIPYDRERVHP-LSIEHLTWLWCILILGYSISMIVFFVEM 573
            ....:...|:.. :.:..|:|::.:...|..||...|.:|:
  Fly   534 TMNDFSPPRLEDYIEVSDLSWVFGMYFTGLGISCCCFGLEL 574



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.