DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ir94b and Ir52a

Sequence 1:NP_732700.2 Gene:Ir94b FlyBaseID:FBgn0051424 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_611041.2 Gene:Ir52a FlyBaseID:FBgn0034023 Length:599 Species:Drosophila melanogaster

Alignment Length:624 Identity:118/625 (19%)
Similarity:216/625 (35%) Gaps:189/625 (30%)


  Fly    10 ILILSQAVSQETEFLQLKYLNNIVRSMIKLHKMETLVIVKHHLDNN-----C---SLQNWNAHGM 66
            |||||.....|.|  :..|      :::||.:...|:.::   ||:     |   ||:  ..|.:
  Fly    90 ILILSCGYDAENE--ENSY------TLMKLQRTRRLIYLE---DNSEPESVCMRYSLK--EQHNI 141

  Fly    67 GIIRTN-DQGKLIMKDTFNSRTLAIICIGQNSHITLLRNVFETFGKVQQKKIILWTQMELKEKFF 130
            .::::: ||     .|||.|      |           .:|:|...|:             ..||
  Fly   142 AMVKSDFDQ-----SDTFYS------C-----------RLFQTPNYVE-------------GHFF 171

  Fly   131 QEISKKSRDLKLLNLLVLKAVTKDKLLIYRLNPFPSPHFKRIENIWTPNDTLFMDTKFNFHGMTA 195
                 |.:.:.:.|...::..|                .:.:.:...|...|:.|.|.....|..
  Fly   172 -----KDQPIYIENFQNMRGAT----------------IRTVADSLVPRTILYRDEKSGETKMMG 215

  Fly   196 VVKHDYNWTIQMGNIR-----------KFP----ISRIEDKEVIEFALKYNLTLQFFNDVERFDI 245
            .:.|..|...|..|.:           |.|    |....::::::.......:|||.|       
  Fly   216 YLGHMINTYAQKLNAKLHFIDTSKLGAKKPSVLDIMNWVNEDIVDIGTALASSLQFKN------- 273

  Fly   246 ELRKRIILKSNSTQPIDS-GIPMVFSSLLIVVPCGN-------YLSIQDVIKVSGIEKWIFYIIL 302
                           :|| ..|.:.:...::||...       |..|.|.:.:|           
  Fly   274 ---------------MDSVWYPYLLTGYCLMVPVPAKMPYNLVYSMIVDPLVLS----------- 312

  Fly   303 VYVIFVLIEITFLGVTILISRQS--RHQMIPNTLVNLCAFRAILGLPFPETRRTSLSLRQLFLAI 365
              :|||:  :....|.|:.::..  ::..:.|.|:|..:.|.:||..||.....|..|:.:...:
  Fly   313 --IIFVM--LCLFSVLIIYTQHLSWKNLTLANILLNDKSLRGLLGQSFPFPPNPSKHLKLIIFVL 373

  Fly   366 ALFGMIFSIFINCKLSSMLTNPCPRPQVNNFEELKTSGLTVVMDHDAENFIE-------KEIGVD 423
            ....::.:......|.|..|.|...|.:.:|.::..|.|.:.:.....|.:.       :||..|
  Fly   374 CFASVMITTMYEAYLQSYFTQPPSEPYIRSFRDIGNSSLKMAISRLEVNVLTSLNNSHFREISED 438

  Fly   424 FFNQYMPRKVTLTFTERAKLLFSLKGNHAFTLFSESFAIIESYQRSKGLRAHCTSEDLIVAERVP 488
            ..         |.|.:.::.|. |:.:     |:.||....|..|..|..    .:..:.||  |
  Fly   439 HL---------LIFDDLSEYLV-LRDS-----FNTSFIFPVSVDRWNGYE----EQQKLFAE--P 482

  Fly   489 RIYILEN---NS--ILDRPLRRFI----------RQMQESGITNHWLKNIPSSLEKNLMQITIPY 538
            ..|:..|   |.  :...||||::          .:..|.|:...|...  |.:|...:.:....
  Fly   483 AFYLATNLCFNQFMLFSPPLRRYLPHRHLFEDHMMRQHEFGLVTFWKSQ--SFIEMVRLGLASME 545

  Fly   539 D--RERVHPLS--IEHLTWLWCILILGYSISMIVFFVEM 573
            |  |:|...:|  ::.::|:..:.:....||...|.:|:
  Fly   546 DLSRKRNEEVSLLLDDISWILKLYLGAMFISSFCFILEI 584



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.