DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ir94b and Ir94c

Sequence 1:NP_732700.2 Gene:Ir94b FlyBaseID:FBgn0051424 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_732701.2 Gene:Ir94c FlyBaseID:FBgn0051423 Length:604 Species:Drosophila melanogaster

Alignment Length:608 Identity:207/609 (34%)
Similarity:352/609 (58%) Gaps:40/609 (7%)


  Fly     1 MSLIFNLLFILILSQAVSQETEFLQLKYLNNIVRSMIKLHKMETLVIVKHHLDNNCSLQNWNAHG 65
            ||.:|.||.:.::..::::.::..|||:|..::..:.:..::.|::::||..|..|.|..||..|
  Fly     1 MSKVFKLLVLPLIYLSLTKGSKNPQLKFLRELINVIEEGREIRTIMVIKHSRDEYCHLDQWNPRG 65

  Fly    66 MGIIRTNDQGKLIMKDTFNSRTLAIICIGQNSHITLLRNVFETFGKVQQKKIILWTQMELKEKFF 130
            ..|:|||:.|.:.:...||.:.:.:.|:|:||...||:::......::|::||||::.|..:...
  Fly    66 SPILRTNEMGSIRISGYFNDQAVILACMGENSDYGLLKSLANAMDNMRQERIILWSEREPTKMLM 130

  Fly   131 QEISKKSRDLKLLNLLVLKAVTKDKLL-----IYRLNPFPSPHFKRIENIWTPNDTLFMDTKFNF 190
            ..||:::.......:::   ||.::.:     :::|||:|:|.|::|.||.....|.|.....:|
  Fly   131 DYISQQADRYNFAQIII---VTMNEDVDAVPSLHQLNPYPTPRFRQITNISNIRRTSFFGCGLSF 192

  Fly   191 HGMTAVVKHDYNWTIQMGNIR--------KFPISRIEDKEVIEFALKYNLTLQFFNDVE----RF 243
            .|.||::|...     :.|||        ..|:|.::|.|:::||:||||:|:.::..|    .|
  Fly   193 QGKTAILKESV-----VSNIRFKVWSPSGPIPLSELKDYEIVQFAVKYNLSLKLYDQNESKSDHF 252

  Fly   244 DIELRKRIILKSNSTQPIDSGIPMVF------SSLLIVVPCGNYLSIQDVIKVSGIEKWIFYIIL 302
            ||:|....|.|...||       |.|      .||:::|||.......||:...|:.|.|..:::
  Fly   253 DIQLGPLFITKDFPTQ-------MAFVSPNTACSLIVIVPCSPKWRFMDVLHKLGVLKLIGCLLI 310

  Fly   303 VYVIFVLIEITFLGVTILISRQSRHQMIPNTLVNLCAFRAILGLPFPETRRTSLSLRQLFLAIAL 367
            .|.:|||||...|.:|..||.:.......|.|:|..|||.||||||||.||:|:|||||||.|::
  Fly   311 AYAVFVLIETLILWLTHRISGREVRLTSLNQLLNPRAFRGILGLPFPEFRRSSISLRQLFLVISV 375

  Fly   368 FGMIFSIFINCKLSSMLTNPCPRPQVNNFEELKTSGLTVVMDHDAENFIEKEIGVDFFNQYMPRK 432
            ||:::|.|::|.||::||.|...|||.||:||:.|||..:||....:||||.|..:||:..:|..
  Fly   376 FGLVYSNFVSCTLSALLTKPAQNPQVRNFKELRDSGLITIMDKYTHSFIEKHIDPEFFDHVLPHY 440

  Fly   433 VTLTFTERAKLLFSLKGNHAFTLFSESFAIIESYQRSKGLRAHCTSEDLIVAERVPRIYILENNS 497
            :.|...|..:::::...::::.:::.::..:.:.|:|...|..|.||.|.:|..:||:|:|.|||
  Fly   441 LILQKKEALRMIWNFNDSYSYVMYTTTWKSLNTVQKSFDERVFCESESLTIAWNLPRMYVLGNNS 505

  Fly   498 ILDRPLRRFIRQMQESGITNHWLKNIPSSLEKNLMQITIPYD-RERVHPLSIEHLTWLWCILILG 561
            :|...|.|:|..|.::||.:.|.:.:|..| |.|..:|.|.. :|...||||:||:|:|.:|.:|
  Fly   506 VLKWMLSRYITYMPQTGIPDSWTEQLPKVL-KLLYNVTSPRRIKEGAVPLSIQHLSWIWHLLFIG 569

  Fly   562 YSISMIVFFVEMSLKRRKKNLEN 584
            .||:.:||.||:.|::..::..|
  Fly   570 ESIATLVFIVEILLQKSNQHTSN 592



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131251231
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.