DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ir94b and Ir94f

Sequence 1:NP_732700.2 Gene:Ir94b FlyBaseID:FBgn0051424 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_732868.2 Gene:Ir94f FlyBaseID:FBgn0051225 Length:558 Species:Drosophila melanogaster

Alignment Length:579 Identity:103/580 (18%)
Similarity:214/580 (37%) Gaps:177/580 (31%)


  Fly    88 LAIICIGQNSHITLLRNVFETFGKVQQKKIILWTQMELKEKFFQEIS------KKSRDLKLLNLL 146
            |.:.|:..:.:..:|..:.....:::...::|  |:...|...||::      |.|:|||:.|::
  Fly    79 LVVSCLRFHQYQEVLLALSLMLDQMRSMPVVL--QLCGDEDSMQELNSARLLLKHSQDLKMPNVV 141

  Fly   147 VLKAVTKDKLLIYRLNPFPSPHFKRIENIWTPNDTLFMDTKFNFHGMTAVVKHDYNWTIQMGNIR 211
            :|.:.......:|....||..:.:::  ::....|||                    ..::||::
  Fly   142 LLSSTFFTSATLYSYEMFPEFNVQKL--VYQAYLTLF--------------------PYKLGNLK 184

  Fly   212 KFPISRIEDKE-----------------------VIEFALKYNLTLQFFNDVE---RFDIELRKR 250
            ..||..:.|..                       :||||...|.|||.  .:|   ...|:|.:.
  Fly   185 GHPIRTVPDNSEPLTIVRKTLNGSIAIDGLVWQFMIEFAKHINATLQL--PIEPHPEKSIKLVQI 247

  Fly   251 IILKSNSTQPIDS-----------------GIPMVFSSLLIVVP----CGNYLSIQDVIKVSGIE 294
            :.|..|.|..|.:                 |.||:..:..:::|    .|::.::..::|    .
  Fly   248 LDLVRNQTVDIAASLRPYSLNVQRSSTHIYGSPMMVGNWCMMLPTERVIGSHEALTRLMK----S 308

  Fly   295 KWIFYIILVYVIFVLIEITFLGVTILISRQSRHQMIPNTLVNLCAFRAILGLPFPETRRTSLSLR 359
            .|.:.|:|:          |..|...:::::|                        .|.:.:.|.
  Fly   309 PWTWLILLL----------FYSVHRFLAQKTR------------------------LRSSLIHLI 339

  Fly   360 QLFLAIALFGMIFSIFINCKLSSMLTNPCPRPQVNNFEELKTSGLTV------VMDHD------- 411
            :|.:.::|.     .|:..:||:....|.....::|.::::.|||.:      .|::.       
  Fly   340 KLLINLSLI-----CFLQAQLSAYFIGPQKVNHISNMQQVEESGLKIRGMRGEFMEYPIDMRSRY 399

  Fly   412 AENFIEKEIGVDFFNQYMPRKVTLTFTERAKLLFSLKGNHAFTLFSESFAIIESYQRSKGLRAHC 476
            |.:|:..::                |.:.|:...||..::.:|:.|..:.:.:..||........
  Fly   400 ASSFLLHDL----------------FFDLAQYRNSLNTSYGYTVTSVKWELYKEAQRHFRRPLFR 448

  Fly   477 TSEDLIVAERVPRIYILENNSILDRPLRRFIRQMQESGITNHWLKNIPSSLEKNLMQITIPYDRE 541
            .||::.|.:......|.::|.|.....|.||.:|.|:|:...|.        :....:.:...|.
  Fly   449 YSEEICVQKLSLFSLIQQSNCIYCYRSRIFILRMHEAGLIRLWY--------RRSYYVMVTAGRF 505

  Fly   542 RVHPLSIEH----LTWL-WCILIL----GYSISMIVFFVEMSLKRRKKNLENRAPNICI 591
            .:..||..|    :.|. |..::|    |...|::||.:|:::         ...|:|:
  Fly   506 PIGDLSTVHRAQPIRWTEWQNVVLLHGVGLLFSVVVFVIELTV---------HYANVCL 555



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.