DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ir94b and Ir7g

Sequence 1:NP_732700.2 Gene:Ir94b FlyBaseID:FBgn0051424 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_572413.2 Gene:Ir7g FlyBaseID:FBgn0029968 Length:561 Species:Drosophila melanogaster

Alignment Length:416 Identity:84/417 (20%)
Similarity:149/417 (36%) Gaps:127/417 (30%)


  Fly   184 MDTKFNFHGMTAVVKHDYNWTIQMGNIRKFPISRIEDKEVIEFALKYNLTLQFFNDVERFDIELR 248
            |:....|.|:...:|:...||      .|..:.::..:.:...|:.|                :|
  Fly   249 MNFSIQFSGLQDQLKNRTTWT------EKQLLQKLVQERIAHLAIGY----------------VR 291

  Fly   249 KRIILKSNSTQPIDSGIPMVFSSLLIVVPCGNYLSIQDVIKVSGIEKWIF------YIILV---- 303
            |||...:|.|.........|...||:           :...::.:|.|.|      :|.|:    
  Fly   292 KRIQYATNLTPVFPHYSNRVVGCLLL-----------NAHNLTSLEIWSFPFQALTWICLLLFAS 345

  Fly   304 YVIF-VLIEITFLGVTILISRQSRHQMIPNTLVNLC--AFRAILGLPFPETRRTSLSLRQLFLAI 365
            ::|| :::...:..:...|.|...||.:|..|.:|.  .:.|::|      |.|...||::    
  Fly   346 WLIFGLIVRSMYSALLFFILRYHLHQRLPGNLQDLTHGDYAAVMG------RTTLQDLREV---- 400

  Fly   366 ALFGMIFSIFINCKLSSMLTNPCPRPQVNNFEELKTSGLTVVMDHDAENFIEKEIGVDFFNQYMP 430
                                     |.:.:...||    :|::..:.|..:.:.:.         
  Fly   401 -------------------------PSLQDLLGLK----SVIVTSEREEEVLRTLD--------- 427

  Fly   431 RKVTLTFTERAKLLFSLKGNHA--FTLFSESFAIIESYQRSKGLRA---HCTSEDLIVAERVPRI 490
               ..|..|.|       |:|.  |.|.|:. |::...||  |.||   |...:|  |.|:...|
  Fly   428 ---RCTLREGA-------GSHPLFFGLISQD-ALLHLTQR--GHRAGAYHIIPQD--VLEQQLAI 477

  Fly   491 YILENNSILDRPLRRFIRQMQESGITNHWLKNIPSSLEKNLMQITIPYDRERVHPLSIEHLTWLW 555
            | |:.:|.|...|...:..::..|:.:||...:.|   :...:....|..:|:....      ||
  Fly   478 Y-LQKHSHLASHLDHLVMSIRSVGLVHHWAGQMAS---ERYFRSRFLYREKRIRQPD------LW 532

  Fly   556 CILILG---YSISMIVFFVEMSLKRR 578
            .:.||.   |.:|::||..|:...||
  Fly   533 AVYILTAGLYLLSLVVFICELLASRR 558



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.