DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ir94b and Ir7c

Sequence 1:NP_732700.2 Gene:Ir94b FlyBaseID:FBgn0051424 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_001245572.1 Gene:Ir7c FlyBaseID:FBgn0029966 Length:625 Species:Drosophila melanogaster

Alignment Length:579 Identity:118/580 (20%)
Similarity:203/580 (35%) Gaps:190/580 (33%)


  Fly   117 IILWTQME------LKEKFFQEISKKSRDLKLLNLLVLKA---VTKDKLL-IYRLNPFPSPH--- 168
            ::::|.:|      ||..|          .:|||:.||..   :.:|..: :|...|: .||   
  Fly   124 LVIYTGLEDQPMESLKIMF----------RRLLNMYVLNVNVFLQRDGTVHLYTYYPY-GPHHCQ 177

  Fly   169 ------FKRIENIWTP------NDTLFMDTKFNFHGMTAVV-KHDYNWTIQMGNIRKFP----IS 216
                  :...:::..|      ...||.....|.||...|| ..::...:.:.:..|.|    |.
  Fly   178 SSLPVYYTAFQDLAAPANGFGLTKPLFPRKLTNMHGCEMVVATFEHRPYVIIEDDPKTPGGRSIH 242

  Fly   217 RIEDKEVIEFALKYNLTLQFFNDVERFDIELRKRIILKSNST----QPIDSGIPMVF-------- 269
            .||.......|.:.|.|::.   ||:.| :.|..|:...|.|    ..:|..:.:.|        
  Fly   243 GIEGLIFRSLAERMNFTIKL---VEQKD-KNRGEILPDGNFTGILKMMVDGEVNLTFVCFMYSKA 303

  Fly   270 -SSLL------------IVVPCGNYLSIQDVIKVSGIEKWIFY-IILVYVIFVLIEITFLGVT-- 318
             |.|:            :|||.|.  ||..:.:::...::|.: .|||.:||..:.|..|.:|  
  Fly   304 RSDLMLPSTSYTSFPIVLVVPSGG--SISPMGRLTRPFRYIIWSCILVSLIFGFVLICLLKITAL 366

  Fly   319 -----ILISRQSRHQMIP---------------NTLVNLCAFRAILGLPFPETRRTSLSLRQLFL 363
                 :::.|::|   :|               |...|...:..::.|           |:.|.|
  Fly   367 PGLRNLVLGRRNR---LPFMGMWASLLGGLALYNPQRNFARYILVMWL-----------LQTLIL 417

  Fly   364 AIALFGMIFSIFINCKLSSMLTNPCPRPQVNNFEELKTSGLTVVMDHDAENFIEKEIGVDFFNQY 428
            ..|..|.::.:..:.::.|.:                 ..|:.|:..|.|..|...:.. .|...
  Fly   418 RAAYTGQLYLLLQDVEMRSPI-----------------KSLSEVLAKDYEFRILPALRT-IFKDS 464

  Fly   429 MPRKVTLTFTERAKLLFSLKGNHAFTLFSESF-------------AIIESYQ-----RSKGLRAH 475
            ||   |..|             ||.....||.             |:::...     ||...:.|
  Fly   465 MP---TTNF-------------HAVLSLEESLYRLRDEDDPGITVALLQPTVNQFDFRSGPNKRH 513

  Fly   476 CT--SEDLIVAERVPRIYILENNSILDRPLRRFIRQMQESGITNHW-------LKNIPSSLEKNL 531
            .|  .:.|:.|   |..:.:..:|...|.:.|.|..|..|||...:       :|.:  |..:||
  Fly   514 LTVLPDPLMTA---PLTFYMRPHSYFKRRIDRLIMAMMSSGIVARYRKMYMDRIKRV--SKRRNL 573

  Fly   532 MQITIPYDRERVHPLSIEHLTWLWCILILGYSISMIVFFVEMSLK-----RRKKNLENR 585
                      ...||||..|:.::......|.:::|||.:|:...     ||..|:.||
  Fly   574 ----------EPKPLSIWRLSGIFVCCAGLYLVALIVFILEILTTNHRRLRRAFNVINR 622

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ir94bNP_732700.2 None
Ir7cNP_001245572.1 Lig_chan-Glu_bd 225..287 CDD:214911 15/66 (23%)
Lig_chan 343..593 CDD:278489 59/313 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.