DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ir94b and Ir52c

Sequence 1:NP_732700.2 Gene:Ir94b FlyBaseID:FBgn0051424 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_725470.1 Gene:Ir52c FlyBaseID:FBgn0050468 Length:599 Species:Drosophila melanogaster

Alignment Length:554 Identity:113/555 (20%)
Similarity:208/555 (37%) Gaps:126/555 (23%)


  Fly    83 FNSRTLAIICIGQNSHITLLRNVFETFGKVQQKKIILWTQMELK-EKFFQEISKKSRDLKLLNLL 146
            |:|.||.:.|..|:..    ...:.|..|:|..:.::..:..:| |......|||.:.    |:.
  Fly    83 FSSLTLILSCNFQDER----EENYRTLMKLQTSRRLILLKGHIKPESVCDFYSKKEQH----NVA 139

  Fly   147 VLKAVTKDKLLIYRLNPFPSPHFKRIENIWTPNDTLFMDTKFNFHGMTAVVKHDYNWTIQMGNIR 211
            ::|.......::|....|...::::: |:: ...:::.|...|.||.                  
  Fly   140 MVKENFYQLEVVYSCRLFQDQNYEKL-NLF-DGKSIYKDQFRNMHGA------------------ 184

  Fly   212 KFPISRIEDKE------------------------VIEFALKYNLTLQFFNDVERFDIELRKRII 252
              ||..:.|||                        :.:|..|.|.|:|...|:.:.|.|:....|
  Fly   185 --PIRTLSDKEPPRTIPYIDSKTGEEKFKGYVGMLISQFVKKVNATMQIREDLIKDDEEVSFVDI 247

  Fly   253 LKSNSTQPIDSGI----------------PMVFSSLLIVVPCGNYLSIQDVIKVSGIEKWIFYII 301
            ....|...:|.||                |.:.||...:.|..:.|...||          :..|
  Fly   248 TNFTSNDILDIGICEARTLEMSNYDAISYPYLMSSYCFMAPLPDSLPFSDV----------YMAI 302

  Fly   302 LVYVIFVLIEITFLGVTILI----SRQSRHQMIPNTLVNLCAFRAILGLPFPETRRTSLSLRQLF 362
            :...|.::..|.|...::||    .|..|...|.:.|:|....|..|..|||..|:.:..|:.:|
  Fly   303 VAPSILIMFLIIFCICSVLIIYIQERSYRSLTIRSVLMNDICLRGFLAQPFPFPRQYNRKLKLIF 367

  Fly   363 LAIALFGMIFSIFINCKLSSMLTNPCPRPQVNNFEELKTSGLTVVMDHDAENFIEKEIGVDFFNQ 427
            :.:....:|.:......|.:.|..|...|::.:|:::|.|..|:     |.|..|:|. ::..|.
  Fly   368 MLVCFSSLISTTMYTAYLQAFLWGPPIEPRLTSFDDVKKSRYTM-----AINIYEREF-LEALNV 426

  Fly   428 YMPRKVTLTFTERAKLLFSLKGNHAFTLFS-ESFAIIESYQRSK-GLRAHCTSEDLIVAERVPRI 490
            .:.......:.:.:||..:...|:.|.:.: :.|.|.|..:..| .:..:|.:            
  Fly   427 SLEDVEIYDYGKFSKLRSTFNTNYLFPVTALQWFTINEEQKLFKYKIFYYCDA------------ 479

  Fly   491 YILENNSILDRPLRR-------FIRQM---QESGITNHWL-KNIPSSLEKNLMQI-----TIPYD 539
            :.|....||..||||       |...|   :|.|:|.:|: ::....:..||...     .:..|
  Fly   480 FCLNQFDILSIPLRRHLPYRDIFEEHMLLQKEFGLTKYWIDQSYRDMIRANLTTFKDFSPLLEND 544

  Fly   540 RERVHPLSIEHLTWLWCILILGYSISMIVFFVEM 573
            ...||     :|.|::.:..:|..:.:..|.:|:
  Fly   545 YIEVH-----NLYWVFTMYFVGMGMGLCFFILEI 573



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.