DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ir94b and Ir51b

Sequence 1:NP_732700.2 Gene:Ir94b FlyBaseID:FBgn0051424 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_725440.1 Gene:Ir51b FlyBaseID:FBgn0050081 Length:597 Species:Drosophila melanogaster

Alignment Length:649 Identity:141/650 (22%)
Similarity:260/650 (40%) Gaps:140/650 (22%)


  Fly     1 MSLIFNLLFILILSQAVSQETEFLQLKYLNNIVRSMIKLHK--METLVIVKHHL---DNNCSLQN 60
            |..:..||.:::|....:.......||    .|.|:|...:  :.|.:.|.|:.   |.| .|..
  Fly     1 MCKVLTLLVVILLLALTNAAYNVTLLK----SVLSLISTREPWINTPIFVGHNTQGGDLN-DLII 60

  Fly    61 WNAHGMGI-------------IRTNDQGKLIMKDTFNSRTLAIICIGQNSH----ITLLRNVFET 108
            |....||:             ||.....|:   ..:|...| ..|  .:.|    :||.||:   
  Fly    61 WLHQTMGVTSLTMNLFLQPEHIRPLGHFKI---TRYNGIAL-FFC--HDKHDIMWLTLDRNL--- 116

  Fly   109 FGKVQQKK--IILWTQMELKEKFFQEISKKSRDLKLLNLLVLKAVTKDKLLIYRLNPFPSPHFKR 171
             .|:::.:  |||..|....:...:.|.......:.||:|||:   :|:|  |...|:|:..|.:
  Fly   117 -RKLRRIRLIIILRNQRSGSQGAIKSIFNALWQYQFLNVLVLQ---RDQL--YSYTPYPAMRFFK 175

  Fly   172 IENIWTPNDTLFMDTKFNFHG--MTAVVKHDYNWTIQMGNIRKFPISRIEDKEVIEFALK----- 229
            :: |.|  :.||.....||||  ::...::|......:.:    |:::  .::|:.:|.:     
  Fly   176 LD-IHT--EPLFPHAARNFHGYVVSTPAENDIPRVFHVHD----PLTK--SRKVLGYAYRTFVEY 231

  Fly   230 ---YNLTLQFFNDVERFD--------------------IELRKRIILKSNSTQPIDSGIPMVFSS 271
               ||.:|:..|..|..|                    |.|...:.....:|:    ..|::...
  Fly   232 LDHYNASLRLTNPDENLDPTTSVNMNHIVQLIIDGQLEISLHPYVFTPPTATK----SYPLLIYP 292

  Fly   272 LLIVVPCGNYLSIQDVIKVSGIEKWIFYIILVYVIFVLIEITFLGVTILISRQSRHQMIPNTL-V 335
            ..::||..|.:. :.:..:...:.:.:||:|..|.::      .|:...||.:......|..| :
  Fly   293 NCLIVPMRNEIP-RHMYLLRPFQLYSWYILLFAVFYI------TGILYCISPKLNKSSWPQRLGL 350

  Fly   336 N-LCAFRAILGLPFPET--RRTSLSLRQLFLAIALFGMIFSIFINCKLSSMLTNPCPRPQVNNFE 397
            | |.|...||.:..|.|  |.|...| .:||.:::.|.:.:.:.|.:|.|..|......|||:.:
  Fly   351 NFLDAISKILFISPPITIYRPTWRHL-IIFLQLSVLGFMSTSWYNIELDSFFTTIVVGEQVNSMD 414

  Fly   398 ELKTSGLTVVMDHDAENFIEKEIGVDFFNQYM-PR--------KVTLTFTERAKLLFSLKGNHAF 453
            :|.         |..:..:.||..::.|.::: ||        .|.:..:|:...|.|...:.|:
  Fly   415 QLV---------HQQQRVLVKEYEINTFLRHVEPRLVEKVSRLLVPVNASEQVSALLSFNRSFAY 470

  Fly   454 TLFSES---FAIIESYQRSKGLR--AHCTSEDLIVAERVPRI-YILENNSILDRPLRRFIRQMQE 512
            ....|.   ||:.:.|......|  :.|...        |.| |.:..:|.|:..|..||.::|:
  Fly   471 PFTEERWQFFAMQQQYAFKPIFRFSSACLGS--------PHIGYPMRVDSHLETSLNHFILKIQD 527

  Fly   513 SGITNHW-LKNIPSSLEKNLMQI---TIPYDRERVHPLSIEHLTWLWCILILGYSISMIVFFVE 572
            :|:.||| :.:...::....::.   .:.|     ..:.::.|...||:|.:|:.:|.:||..|
  Fly   528 TGLLNHWVVSDFNDAMRAGYVRFVDNVLGY-----QSIDVDTLRLGWCVLGIGWILSALVFSCE 586



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.