DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31321 and MFSD14B

Sequence 1:NP_731899.1 Gene:CG31321 FlyBaseID:FBgn0051321 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_115947.2 Gene:MFSD14B HGNCID:23376 Length:506 Species:Homo sapiens

Alignment Length:491 Identity:99/492 (20%)
Similarity:161/492 (33%) Gaps:154/492 (31%)


  Fly   170 PIIGEALS-------FTCQIISSIFFESLP---MEFGAYCEAIVPALFGGLTFCLMAIYSYITIA 224
            |:|| |||       |   ::.::||...|   |....:....:.::.|..:.....|::|:...
Human    98 PLIG-ALSDVWGRKPF---LLGTVFFTCFPIPLMRISPWWYFAMISVSGVFSVTFSVIFAYVADV 158

  Fly   225 TPEEDRVFRFG----IFAMFVTGVPFIGQPISGVLFTTLGYTWSFASAIVF---QLIAIFYIIFF 282
            |.|.:|...:|    .||..:...|.||..:|.          |:..::|.   .::|:..|.|.
Human   159 TQEHERSTAYGWVSATFAASLVSSPAIGAYLSA----------SYGDSLVVLVATVVALLDICFI 213

  Fly   283 IKEVKTTPTTSTTANEPPPLPTSLPPKQQGADNMAYETTNLDELQGNKNVNFQLTPQMEPKVEVV 347
            :..|            |..||..:.|...|| .::::..:                         
Human   214 LVAV------------PESLPEKMRPVSWGA-QISWKQAD------------------------- 240

  Fly   348 PPKRSLLKELFDPTLVLDCIRFPLVKRPNNGRMLLILLLCAYFLTVGPTSGENDYWYRFTLKKLA 412
             |..||.|...|.|::|.||                    ..||:..|.:|:.            
Human   241 -PFASLKKVGKDSTVLLICI--------------------TVFLSYLPEAGQY------------ 272

  Fly   413 WNGNDFSIYL--TLSSGAALVGTFIG----------TAILSKLLKVSDSMIGMLSALSI-VCSRV 464
               :.|.:||  .:..|:..:..||.          ||.||.|::...:...:|..|.. :....
Human   273 ---SSFFLYLRQVIGFGSVKIAAFIAMVGILSIVAQTAFLSILMRSLGNKNTVLLGLGFQMLQLA 334

  Fly   465 LFAFSSSTASFYVAGVVDMFVSLRVIAIKTIGSSIVAGDELSKMYSIF--------GISEPIAQF 521
            .:.|.|.....:.||.|....|:...||..:.|.....|:......|.        |:...:..|
Human   335 WYGFGSQAWMMWAAGTVAAMSSITFPAISALVSRNAESDQQGVAQGIITGIRGLCNGLGPALYGF 399

  Fly   522 IF-----------PPIFSEIYKSTVDSFPGAIWLFGEIFYIPNVLVFVVCYFLLRRRKANEEKSV 575
            ||           |.:.|..........||..:|||....:   :.|:|..|:....||    |.
Human   400 IFYMFHVELTELGPKLNSNNVPLQGAVIPGPPFLFGACIVL---MSFLVALFIPEYSKA----SG 457

  Fly   576 VEMEQNGGA----NGGNRAS------VVPDSEITSL 601
            |:...|..:    |...|.|      ::.||.|..|
Human   458 VQKHSNSSSGSLTNTPERGSDEDIEPLLQDSSIWEL 493

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31321NP_731899.1 MFS 141..>271 CDD:119392 26/115 (23%)
MFS_1 143..>271 CDD:284993 26/115 (23%)
MFS <379..559 CDD:119392 40/212 (19%)
MFSD14BNP_115947.2 MFS 48..450 CDD:119392 87/443 (20%)
MFS_1 49..394 CDD:284993 74/384 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D763423at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.