DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31321 and AT5G42210

Sequence 1:NP_731899.1 Gene:CG31321 FlyBaseID:FBgn0051321 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001318729.1 Gene:AT5G42210 AraportID:AT5G42210 Length:438 Species:Arabidopsis thaliana

Alignment Length:469 Identity:90/470 (19%)
Similarity:171/470 (36%) Gaps:123/470 (26%)


  Fly   104 PDLADLVIGATGFNYTVCKAELEAQILAADVSGKRAPMAAIFPLIVLLFAGGWADRYNKRKPCM- 167
            |.:.|:.:.|      :|..:.|.. ||..:||.:..:..:..||::...|..:|::.::  |: 
plant    29 PVITDISMAA------LCPGKDECS-LAIYLSGFQQVITGVGSLIMMPLVGSLSDKHGRK--CLL 84

  Fly   168 -------IMPIIGEALS---------FTCQIISSIFFESLPMEFGAYCEAIVPALFGGLTFCLMA 216
                   |:|::..|.|         :..:.::||           .||        |...||  
plant    85 TLPMTLNILPLVTLAYSRGATIFYMYYVLKTLTSI-----------VCE--------GSVLCL-- 128

  Fly   217 IYSYITIATPEEDRVFRFGIFAMFVTGVPFIGQPISGVLFTTLGYTWSFASAIVFQLIAIFYIIF 281
            ..:|:....||..|...|||.. .:|...|:...:| ..|.::|.|:..|:|:  .:::..|:..
plant   129 ALAYVADNVPEGRRASAFGILT-GITSCAFVCANLS-ARFLSIGVTFQVAAAM--GILSTLYMRL 189

  Fly   282 FIKEVKTTPTTSTTANEPPPLPTSLPPKQQGAD---NMAYETTNLDELQGNKNVNFQLTPQMEPK 343
            |                   ||.|:.....||.   |....:..|::..|::|..|:       .
plant   190 F-------------------LPDSIRDNSLGAPIVINEKLSSPLLEDCPGHRNRIFR-------A 228

  Fly   344 VEVVPPKRSLLKE---LFDPTLVLDCIRFPLVKRPNNGRMLLILLLCAYFLTVGPTSGENDYWYR 405
            :.:|....||::.   ||...:|                        ::|.::..........| 
plant   229 IRLVHEMASLMRSSVPLFQVAMV------------------------SFFSSLAEAGLHASSMY- 268

  Fly   406 FTLKKLAWNGNDFSIYLTLSSGAALVGTFIGTAILSKLLKVSDSM-IGML---SALSIVCSRVLF 466
            :...|..:|.:.|:..:.:...:..:...:...:|...||....: ||:.   :.:.::|    .
plant   269 YLKAKFHFNKDQFADLMIIVGASGSISQLLFMPVLVPALKEERLLSIGLFFGCAHMFLLC----V 329

  Fly   467 AFSSSTASFYVAGVVDMFVSLRVIAIKTIGSSIVAGDELSKMYSIFGISEPIAQFIFPPIFSE-- 529
            |:||...  |:|.:..:|.......:::|.|..||..|..|...|......:|..|.|..||.  
plant   330 AWSSWVP--YMAAIFALFSIFPSSCMRSIVSKQVASYEQGKAQGIISSICSLANVISPLAFSPLT 392

  Fly   530 ---IYKSTVDSFPG 540
               :.:....:|||
plant   393 DWFLSERAPFNFPG 406

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31321NP_731899.1 MFS 141..>271 CDD:119392 31/147 (21%)
MFS_1 143..>271 CDD:284993 31/145 (21%)
MFS <379..559 CDD:119392 32/172 (19%)
AT5G42210NP_001318729.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.