DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31321 and AT2G16990

Sequence 1:NP_731899.1 Gene:CG31321 FlyBaseID:FBgn0051321 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001031360.1 Gene:AT2G16990 AraportID:AT2G16990 Length:456 Species:Arabidopsis thaliana

Alignment Length:479 Identity:96/480 (20%)
Similarity:183/480 (38%) Gaps:95/480 (20%)


  Fly   104 PDLADLVIGATGFNYTVCKAELEAQILAADVSGKRAPMAAIFPLIVLLFAGGWADRYNKRKPCMI 168
            |.:.|:.:.|      ||....::..||..::|.:.....:..:|::...|..:|||. .|..:.
plant    27 PVITDVTVAA------VCSGPDDSCSLAVYLTGFQQVAIGMGTMIMMPVIGNLSDRYG-IKTILT 84

  Fly   169 MPIIGEALSFTCQIISSIFFESLPMEFGAYCEAIVPALF-GGLTFCLMAIYSYITIATPEEDRVF 232
            :|:   .||....:|.. :...:...:..|...|:.::. .|...||  .|:|:.:......|:.
plant    85 LPM---CLSIVPPVILG-YRRDIKFFYVFYISKILTSMVCEGTVDCL--AYAYVAVNIHGSTRIS 143

  Fly   233 RFGIFAMFVTGVPFIGQPISGVLFTTLGYTWSFASAIVFQLIAIFYIIFFIKEVKTTPTTSTTAN 297
            .|||.|...|.....|..::..|...|.:.   .|||.| .:.:.|:..|:||         ..|
plant   144 AFGILAGIKTIAGLFGTLVARFLPIALTFQ---VSAISF-FVGLVYMRVFLKE---------KLN 195

  Fly   298 EPPPLPTSLPPKQQGADNMAYETTNLDELQGNKNVNFQLTPQMEP-------KVEVVPPKRSLLK 355
            :...            |::.:.|.:.::   :.::|  .|...||       |.:|...|.|.||
plant   196 DDED------------DDLHHGTYHQED---HDSIN--TTMLAEPILNDRPIKTQVFHKKYSSLK 243

  Fly   356 ELFDPTLVLDCIRFPLVKRPNNGRMLLILLLCAYFLTVGPTSGENDYWYRFTLKKLAWNGNDFSI 420
            ::..           |:|   ...:....|:..:|.:...:..|:.:.| |...:..::...|:.
plant   244 DMIS-----------LMK---TSTIFFQALVVTFFSSFSDSGMESAFLY-FLKARFGFDKKQFAD 293

  Fly   421 YLTLSSGAALVGTFIGTAILSKLLKVSDSMIGMLSALS--IVCSRVLFAFSSST--------ASF 475
            .|.|   ..:||:.....:|.:..    |.||....||  :....:..|..|.:        .:.
plant   294 LLLL---ITIVGSISQLFVLPRFA----SAIGECKLLSTGLFMEFINMAIVSISWAPWVPYLTTV 351

  Fly   476 YVAGVVDMFVSLRVIAIKTIGSSIVAGDELSKMYSIFGI---SEPIAQFIFPPIFS-EIYKSTVD 536
            :|.|.:.:..|:..||.:.:|    .|::......|.|:   .:.:|.|:|.|:.: .:.|:...
plant   352 FVPGALFVMPSVCGIASRQVG----PGEQGKVQGCISGVRSFGKVVAPFVFSPLTALFLSKNAPF 412

  Fly   537 SFPG----AIWLFGEIFYIPNVLV 556
            .|||    .|.|...|.:..::|:
plant   413 YFPGFSLLCISLSSLIGFFQSLLI 436

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31321NP_731899.1 MFS 141..>271 CDD:119392 29/131 (22%)
MFS_1 143..>271 CDD:284993 29/129 (22%)
MFS <379..559 CDD:119392 39/197 (20%)
AT2G16990NP_001031360.1 MFS 11..417 CDD:119392 92/459 (20%)
MFS_1 11..395 CDD:284993 85/437 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.