DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31321 and Slc46a3

Sequence 1:NP_731899.1 Gene:CG31321 FlyBaseID:FBgn0051321 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001343931.1 Gene:Slc46a3 MGIID:1918956 Length:460 Species:Mus musculus

Alignment Length:576 Identity:122/577 (21%)
Similarity:208/577 (36%) Gaps:162/577 (28%)


  Fly    39 IEPFFFFYFMASVFNAVAMQ-NFPLDKACRVNLGYNKIVCDT---MLDKSELGIECDD------F 93
            |||       |.:.||.||. ..||    .....|.:|..:|   ....:..|.|||.      |
Mouse     6 IEP-------AILLNAFAMTLTIPL----TAQYVYRRIWEETGNYTFASNSNGSECDQNKSSSIF 59

  Fly    94 DFENTTQGATPDLADLVIGATGFNYTVCKAELEAQILAADVSGKRAPMAAIFPLIV---LLFAGG 155
            .|....|..          |:.||..|                   .|:|:.|.:|   :|.|. 
Mouse    60 AFREEVQKK----------ASLFNLQV-------------------EMSALIPGLVSTFMLLAS- 94

  Fly   156 WADRYNKRKPCMIMPIIGEALSFTCQIISSIFFESLPMEFGAYCEAIVPALFGGLTFCLMAIYSY 220
             :|.:.::.| |::..:|...:.|...:.|.|  .||::. ......:.||||..|....|.::|
Mouse    95 -SDNHGRKLP-MVLSSLGSLGTNTWLCMMSYF--DLPLQL-LIASTFIGALFGNYTTFWGACFAY 154

  Fly   221 ITIATPE-EDRVFRFGIFAMF---VTGVPFIGQPISGVLFTTLGYTWSFASAIVFQLIAIFYIIF 281
            |.....| :.|:.|..|....   |||:..:.   ||.....||:.||:....:..::.:.||:|
Mouse   155 IVDQQKEYKHRIIRIAILDFMLGVVTGLTGLS---SGYFIRELGFVWSYFITAMVLIVNLAYILF 216

  Fly   282 FIKEVKTTPTTSTTANEPPPLPTSLPPKQQGADNMAYETTNLDELQGNKNVNFQLTPQMEPKVEV 346
            |:.:                     |.|:..:     :...:..::.                  
Mouse   217 FLND---------------------PIKESSS-----QIVTMSCIES------------------ 237

  Fly   347 VPPKRSLLKELFDPTLVLDCIRFPLVKRPNNGRM----LLILLLCAYF---LTVGPTSGENDYWY 404
                   ||:||..|       :.|.|..::.|.    |||..|..||   :.:.|.        
Mouse   238 -------LKDLFYRT-------YMLFKNGSSKRQALLCLLIFTLVIYFFVIIGISPI-------- 280

  Fly   405 RFTLKK----LAWNGNDFSIYLTLSS---GAALVGTFIGTAILSKLLKVSDSMIGMLSALSIVCS 462
             |||.:    |.||    .:|:...|   ..:.:.:|:|..:.|..||  |..|..:...:.:..
Mouse   281 -FTLYELGPPLCWN----EVYIGYGSALGSVSFLSSFLGIWLFSYCLK--DIHIAYIGIFTTMVG 338

  Fly   463 RVLFAFSSSTASFYVAGVVDMFVSLRVIAIKTIGSSIVAGDELSKMYSIFGISEPIAQFIFPPIF 527
            ..|.||:.:|...::..:..:|..:.:..::::.|.:|...|...:::.....|.:|.......:
Mouse   339 MTLAAFTRTTLMMFLVRIPFIFTIMPLSVLRSMLSKVVHSTEQGALFACIAFLETLAGVTSTSAY 403

  Fly   528 SEIYKSTVDSFPGAIWLFGE-IFYIPNVLVFVV--------CYFLLRRRKANEEKS 574
            |.||.:||..:||.|:|... :..:|.:.:..|        .|.||...:.:|..|
Mouse   404 SGIYSATVAWYPGFIFLLSAGLLVLPAISLCCVKSIGWEEGSYTLLVHEEPSEHTS 459

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31321NP_731899.1 MFS 141..>271 CDD:119392 36/137 (26%)
MFS_1 143..>271 CDD:284993 35/135 (26%)
MFS <379..559 CDD:119392 43/195 (22%)
Slc46a3NP_001343931.1 MFS_1 72..397 CDD:331686 85/426 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C9581729
eggNOG 1 0.900 E1_KOG2816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D333052at33208
OrthoFinder 1 1.000 FOG0000485
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23507
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.