DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31321 and MFSD14A

Sequence 1:NP_731899.1 Gene:CG31321 FlyBaseID:FBgn0051321 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_149044.2 Gene:MFSD14A HGNCID:23363 Length:490 Species:Homo sapiens

Alignment Length:437 Identity:78/438 (18%)
Similarity:150/438 (34%) Gaps:121/438 (28%)


  Fly   170 PIIGEAL-------SFTCQIISSIFFESLP---MEFGAYCEAIVPALFGGLTFCLMAIYSYITIA 224
            |:|| ||       ||   ::.::||...|   |:...:....|.::.|........:::|:...
Human    90 PLIG-ALSDVWGRKSF---LLLTVFFTCAPIPLMKISPWWYFAVISVSGVFAVTFSVVFAYVADI 150

  Fly   225 TPEEDRVFRFGI----FAMFVTGVPFIGQPISGVLFTTLGYTWSFASAIVF-QLIAIFYIIFFIK 284
            |.|.:|...:|:    ||..:...|.||        ..||..:..:..:|. ..||:..|.|.:.
Human   151 TQEHERSMAYGLVSATFAASLVTSPAIG--------AYLGRVYGDSLVVVLATAIALLDICFILV 207

  Fly   285 EVKTTPTTSTTANEPPPLPTSLPPKQQGADNMAYETTNLDELQGNKNVNFQLTPQMEPKVEVVPP 349
            .|            |..||..:.|...||. :::|                   |.:|       
Human   208 AV------------PESLPEKMRPASWGAP-ISWE-------------------QADP------- 233

  Fly   350 KRSLLKELFDPTLVLDCIRFPLVKRPNNGRMLLILLLC-AYFLTVGPTSGENDYWYRFTLKKLAW 413
                               |..:|:.  |:..::||:| ..||:..|.:|:...::.:..:.:.:
Human   234 -------------------FASLKKV--GQDSIVLLICITVFLSYLPEAGQYSSFFLYLRQIMKF 277

  Fly   414 NGNDFSIYLTLSSGAALVGTFIGTAILSKLLKVSDSMIGMLSALSI-VCSRVLFAFSSSTASFYV 477
            :....:.::.:   ..::.....|.:||.|::...:...:|..|.. :.....:.|.|.....:.
Human   278 SPESVAAFIAV---LGILSIIAQTIVLSLLMRSIGNKNTILLGLGFQILQLAWYGFGSEPWMMWA 339

  Fly   478 AGVVDMFVSLRVIAIKTIGSSIVAGDELSKMYSIF--------GISEPIAQFIFPPIFSEIYKST 534
            ||.|....|:...|:..:.|.....|:...:..:.        |:...:..|||.....|:.:..
Human   340 AGAVAAMSSITFPAVSALVSRTADADQQGVVQGMITGIRGLCNGLGPALYGFIFYIFHVELKELP 404

  Fly   535 VDS------------------FPGAIWLFGEIFYIPNVLVFVVCYFL 563
            :..                  .||..:|||....:   |..:|..|:
Human   405 ITGTDLGTNTSPQHHFEQNSIIPGPPFLFGACSVL---LALLVALFI 448

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31321NP_731899.1 MFS 141..>271 CDD:119392 26/115 (23%)
MFS_1 143..>271 CDD:284993 26/115 (23%)
MFS <379..559 CDD:119392 33/208 (16%)
MFSD14ANP_149044.2 MFS 40..397 CDD:119392 69/382 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.