DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31321 and SLC46A2

Sequence 1:NP_731899.1 Gene:CG31321 FlyBaseID:FBgn0051321 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_149040.3 Gene:SLC46A2 HGNCID:16055 Length:475 Species:Homo sapiens

Alignment Length:440 Identity:89/441 (20%)
Similarity:181/441 (41%) Gaps:80/441 (18%)


  Fly   144 IFPLIVLL------FAGGW-ADRYNKRKPCMIMPIIGEALSFTCQIISSIFFESLPMEFGAYCEA 201
            |:.|:|.|      :..|| :|||: ||..:.|.::|..||....::..:....:.:.:||   |
Human    80 IYNLVVGLSPLLSAYGLGWLSDRYH-RKISICMSLLGFLLSRLGLLLKVLLDWPVEVLYGA---A 140

  Fly   202 IVPALFGGLTFCLMAIYSYITIATPEEDRVFRFGIFAMFVTGVPFIGQPISGVLFTTL-GYTWSF 265
            .:..||||.:.....:.:..::.:.|..|..|..:..:.:....|.|...||.||..: |::   
Human   141 ALNGLFGGFSAFWSGVMALGSLGSSEGRRSVRLILIDLMLGLAGFCGSMASGHLFKQMAGHS--- 202

  Fly   266 ASAIVFQLIAI----FYIIFFIKEVKTTPTTSTTANEPPPLPTSLPPKQQGADNMAYETTNLDEL 326
            ...::....::    |.:::.:..:|...:.:..:.|.|.:.|     ..|... .|.|.:.|:|
Human   203 GQGLILTACSVSCASFALLYSLLVLKVPESVAKPSQELPAVDT-----VSGTVG-TYRTLDPDQL 261

  Fly   327 QGNKNVNFQLTPQMEPKVEVVPPKRSLLKELFDPTLVLDCIRFPLVKRPNNGRMLLILLLCAYFL 391
            .....|....:|..      ..|.::.:..||...::.|               |.::       
Human   262 DQQYAVGHPPSPGK------AKPHKTTIALLFVGAIIYD---------------LAVV------- 298

  Fly   392 TVGPTSGENDYWYRFTLKK-LAWN--------GNDFSIYLTLSSGAALVGTFIGTAILSKLLKVS 447
                  |..|....|.|:: |.||        ...::|::|         :|:|..:.|:..:  
Human   299 ------GTVDVIPLFVLREPLGWNQVQVGYGMAAGYTIFIT---------SFLGVLVFSRCFR-- 346

  Fly   448 DSMIGMLSALSIVCSRVLFAFSSSTASFYVAGVVDMFVSLRVIAIKTIGSSIVAGDELSKMYSIF 512
            |:.:.|:..:|.....:|.||...|..||:|..|.:|..:.|..|::..|.::.|....|::.|.
Human   347 DTTMIMIGMVSFGSGALLLAFVKETYMFYIARAVMLFALIPVTTIRSAMSKLIKGSSYGKVFVIL 411

  Fly   513 GISEPIAQFIFPPIFSEIYKSTVDSFPGAIW-LFGEIFYIPNVLVFVVCY 561
            .:|..:...:...::::||:.|:|.|.|:.: |...:.::..:.:.:|.|
Human   412 QLSLALTGVVTSTLYNKIYQLTMDMFVGSCFALSSFLSFLAIIPISIVAY 461

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31321NP_731899.1 MFS 141..>271 CDD:119392 32/135 (24%)
MFS_1 143..>271 CDD:284993 32/135 (24%)
MFS <379..559 CDD:119392 39/190 (21%)
SLC46A2NP_149040.3 MFS_1 84..421 CDD:284993 78/395 (20%)
MFS <282..453 CDD:304372 42/210 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C9583995
eggNOG 1 0.900 E1_KOG2816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S7720
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D333052at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23507
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.890

Return to query results.
Submit another query.