DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31321 and si:dkey-5g14.1

Sequence 1:NP_731899.1 Gene:CG31321 FlyBaseID:FBgn0051321 Length:601 Species:Drosophila melanogaster
Sequence 2:XP_009303600.1 Gene:si:dkey-5g14.1 ZFINID:ZDB-GENE-091204-361 Length:463 Species:Danio rerio

Alignment Length:477 Identity:103/478 (22%)
Similarity:193/478 (40%) Gaps:101/478 (21%)


  Fly    96 ENTTQGATPDLADLVIGATGFNYTVCKAELEAQILAADVSGKRAPMAAIFP-LIVLLFAGGWADR 159
            |||:|.|          |...|:|..:.|::.   ||.:......::::.| |||.|....::|:
Zfish    46 ENTSQCA----------ANSSNHTSRQEEVQK---AASLFSMYTDLSSMIPSLIVTLLLVSYSDQ 97

  Fly   160 YNKRKPCMIMPIIGEALSFTCQIISSIFFESLPMEFGAY---CEAIVPALFGGLTFCLMAIYSYI 221
             ..||..:|||:|| .|.:|...::..||     :...|   ..:.|.|||||:...|...:||:
Zfish    98 -RGRKITIIMPLIG-TLIYTLSFLTVSFF-----QLNLYLLIVASFVSALFGGIGTMLGGCFSYV 155

  Fly   222 T-IATPEEDRVFRFGIFAMFVTGVPFIGQPISGVLFTTLGYTWSFASAIVFQLIAIFYIIFFIKE 285
            . :....:.:..|..:..|.:..:..:....:|......|:.|.|.::.:||::.:.|.||.::|
Zfish   156 ADLCEDGKQKTLRMAVVDMMIGMLAGVASISTGYFLHAAGFNWPFFTSAIFQVVNLLYAIFILEE 220

  Fly   286 VKTTPTTSTTANEPPPLPTSLPPKQQGADNMAYETTNLDELQGNKNVNFQLTPQMEPKVEVVPPK 350
            .:....:.|.|            ..|...|:|....:|  ..|...                  :
Zfish   221 TRVIDRSETLA------------CCQALRNLACSIYSL--FAGGSR------------------R 253

  Fly   351 RSLLKELFDPTLVLDCIRFPLVKRPNNGRMLLILL------LCAYFLTVGPTSGENDYWYRFTLK 409
            |:.:       |||..|.|..:...|.|.:.:..|      ||...:.||               
Zfish   254 RTWV-------LVLLIITFSSLSFVNTGGLSIFTLYELNEPLCWTEILVG--------------- 296

  Fly   410 KLAWNGNDFSIYLTLSSGAALVGTFIGTAILSKLL-KVSDSMIGMLSALSIVCSRVLFAFSSSTA 473
                       |.:.:|.:..:.:|:|..:.|..| .::.:.|||   ||:..|.::..|:.:|.
Zfish   297 -----------YGSAASTSIFITSFVGVFLFSLCLPNIAIAFIGM---LSVAVSMLMTGFAKTTL 347

  Fly   474 SFYVAGVVDMFVSLRVIAIKTIGSSIVAGDELSKMYSIFGISEPIAQFIFPPIFSEIYKSTVDSF 538
            :.::..:..||..:....::::.|.:|:..|...:::....:|.::.......||.||.:||...
Zfish   348 TMFLVRIPAMFAIMPFPVLRSMMSKVVSKSEQGALFACVAFTETLSTNGSAASFSRIYAATVAWC 412

  Fly   539 PGAIWLFGE-IFYIPNVLVFVV 559
            ||.::|.|. :..||..|:.::
Zfish   413 PGFVFLLGAGLCLIPMSLLGIL 434

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31321NP_731899.1 MFS 141..>271 CDD:119392 33/135 (24%)
MFS_1 143..>271 CDD:284993 33/133 (25%)
MFS <379..559 CDD:119392 38/188 (20%)
si:dkey-5g14.1XP_009303600.1 MFS 79..435 CDD:119392 92/432 (21%)
MFS_1 81..393 CDD:284993 79/387 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C9582411
eggNOG 1 0.900 E1_KOG2816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D333052at33208
OrthoFinder 1 1.000 FOG0000485
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23507
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.