DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31321 and slc46a3

Sequence 1:NP_731899.1 Gene:CG31321 FlyBaseID:FBgn0051321 Length:601 Species:Drosophila melanogaster
Sequence 2:XP_009303566.1 Gene:slc46a3 ZFINID:ZDB-GENE-100105-2 Length:475 Species:Danio rerio

Alignment Length:449 Identity:100/450 (22%)
Similarity:182/450 (40%) Gaps:78/450 (17%)


  Fly   147 LIVLLFAGGWADRYNKRKPCMIMPIIGEALSFTCQIISSIFFESLPMEFGAYCEAIVPALFGGLT 211
            ||..|....::| |..||..::.|::||||.....::.|.|..||..   ....:.:..|.||..
Zfish    83 LISALLLVSYSD-YCGRKVAIVPPLVGEALHALSYVLVSRFSFSLNY---LLASSFMSGLMGGPP 143

  Fly   212 FCLMAIYSYITIATPEE------DRVFRFGIFAMFVTGVPFIGQPISGVLFTTLGYTWSFASAIV 270
            ..:...::|:.....|:      .|:.|..:....:||:..:   .:|......|:||.|.:|:.
Zfish   144 TLIGGCFAYVADLCGEDLEGQKTVRMARLDMILGVLTGLASL---CTGFFIKAAGFTWPFLTAVF 205

  Fly   271 FQLIAIFYIIFFIKEVKTTPTTSTTANEPPPLPTSLPPKQQGADNMAYETTNLDELQGNKNVNFQ 335
            ..||.:.|::..:||....|.::.:.:.|                .|.|...|.:.|.       
Zfish   206 LHLINLLYVLVVLKESLVLPNSAVSTSSP----------------SASEAPRLRQTQA------- 247

  Fly   336 LTPQMEPKVEVVPPKRSLLKELFDPTLVLDCIRFPLVKRPNNGRMLLILLLCAY-FLTVGPTSGE 399
            ||.:::...                      :.|....|..|  ::|:|:|.|: |..:....| 
Zfish   248 LTTRLQGVY----------------------LLFAASNRRRN--VVLLLMLAAFAFFKLALQGG- 287

  Fly   400 NDYWYRFTLKK----LAWNGNDFSIYLTLSSGAALVGTFIGTAILSKLLKVSDSMIGMLSALSIV 460
               |..|.|.:    |.|: ..|..|.:..|.|..:.:|.|.|:||:.|  .|:.|.:|..:|:.
Zfish   288 ---WSIFILYELNTPLCWS-EVFVGYGSALSTAIYLVSFAGVALLSRCL--PDAYIILLGLMSVA 346

  Fly   461 CSRVLFAFSSSTASFYVAGVVDMFVSLRVIAIKTIGSSIVAGDELSKMYSIFGISEPIAQFIFPP 525
            ...::.||:.:|...::..:..:...:....::::.|.||:|.|...|::.....|.::..:...
Zfish   347 AGLIMAAFAKTTLLMFLVRLPLLLSIMPTPVLRSMMSKIVSGSEQGAMFACVAFVEMLSVGVSFT 411

  Fly   526 IFSEIYKSTVDSFPGAIWLFGE-IFYIPNVLVFVVCYFLLRRRKANEE--KSVVEMEQN 581
            :|:.||.:|:..|.|..:|... :..||:.|   :|..|..|....||  |....||.:
Zfish   412 VFNSIYAATLSWFSGFSFLLAAGLTVIPSAL---ICVILCLRLDVYEESIKLTESMENH 467

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31321NP_731899.1 MFS 141..>271 CDD:119392 31/130 (24%)
MFS_1 143..>271 CDD:284993 31/130 (24%)
MFS <379..559 CDD:119392 45/186 (24%)
slc46a3XP_009303566.1 MFS_1 77..409 CDD:284993 82/387 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C9582721
eggNOG 1 0.900 E1_KOG2816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D333052at33208
OrthoFinder 1 1.000 FOG0000485
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23507
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.