DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31321 and mfsd14a

Sequence 1:NP_731899.1 Gene:CG31321 FlyBaseID:FBgn0051321 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_001016552.1 Gene:mfsd14a XenbaseID:XB-GENE-1001416 Length:488 Species:Xenopus tropicalis

Alignment Length:442 Identity:81/443 (18%)
Similarity:152/443 (34%) Gaps:118/443 (27%)


  Fly   170 PIIGEAL-------SFTCQIISSIFFESLP---MEFGAYCEAIVPALFGGLTFCLMAIYSYITIA 224
            |:|| ||       ||   ::.::||...|   |:...:....|.::.|........:::|:...
 Frog    89 PLIG-ALSDVWGRKSF---LLLTVFFTCAPIPLMKISPWWYFAVISVSGVFAVTFSVVFAYVADI 149

  Fly   225 TPEEDRVFRFGI----FAMFVTGVPFIGQPISGVLFTTLGYTWSFASAIVFQLIAIFYIIFFIKE 285
            |.|.:|...:|:    ||..:...|.||..:..|....|       ..::...||:..|.|.:..
 Frog   150 TQEHERSMAYGLVSATFAASLVTSPAIGAYLGRVYGDNL-------VVLLATAIALLDICFILVA 207

  Fly   286 VKTTPTTSTTANEPPPLPTSLPPKQQGADNMAYETTNLDELQGNKNVNFQLTPQMEPKVEVVPPK 350
            |            |..||..:.|...||. :::|                   |.:|        
 Frog   208 V------------PESLPEKMRPASWGAP-ISWE-------------------QADP-------- 232

  Fly   351 RSLLKELFDPTLVLDCIRFPLVKRPNNGRMLLILLLC-AYFLTVGPTSGENDYWYRFTLKKLAWN 414
                              |..:|:.  |:..::||:| ..||:..|.:|:...::.:..:.:.::
 Frog   233 ------------------FASLKKV--GQDSIVLLICITVFLSYLPEAGQYSSFFLYLRQIMDFS 277

  Fly   415 GNDFSIYLTLSSGAALVGTFIGTAILSKLLKVSDSMIGMLSALSI-VCSRVLFAFSSSTASFYVA 478
            ....:.::.:   ..::.....|.:||.|::...:...:|..|.. :.....:.|.|.....:.|
 Frog   278 PESVAAFIAV---LGILSIIAQTVVLSLLMRSIGNKNTILLGLGFQILQLAWYGFGSEPWMMWAA 339

  Fly   479 GVVDMFVSLRVIAIKTIGSSIVAGDELSKMYSIF--------GISEPIAQFIFPPIFSEIY---- 531
            |.|....|:...|:..:.|.....|:...:..:.        |:...:..|||.....|:.    
 Frog   340 GAVAAMSSITFPAVSALVSRTADADQQGVVQGMITGIRGLCNGLGPALYGFIFYIFHVELNEMPI 404

  Fly   532 ------------KSTVDS-FPGAIWLFGEIFYIPNVLVFVVCYFLLRRRKAN 570
                        ||..:| .||..:|||....:   |..:|..|:......|
 Frog   405 TETEHVGKVTAPKSEQNSIIPGPPFLFGSCSVL---LALLVALFIPEHTNLN 453

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31321NP_731899.1 MFS 141..>271 CDD:119392 25/115 (22%)
MFS_1 143..>271 CDD:284993 25/115 (22%)
MFS <379..559 CDD:119392 36/207 (17%)
mfsd14aNP_001016552.1 MFS 39..396 CDD:119392 68/381 (18%)
MFS_1 41..385 CDD:284993 65/370 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.