DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31321 and Slc46a1

Sequence 1:NP_731899.1 Gene:CG31321 FlyBaseID:FBgn0051321 Length:601 Species:Drosophila melanogaster
Sequence 2:NP_081016.2 Gene:Slc46a1 MGIID:1098733 Length:459 Species:Mus musculus

Alignment Length:417 Identity:88/418 (21%)
Similarity:152/418 (36%) Gaps:89/418 (21%)


  Fly   154 GGWADRYNKRKPCMIMPIIGEALSFTCQIISSIFFESLPMEFG------AYCEAIVPALFGGLTF 212
            |.|:||.. |:|.:::..:|..|    |.:.|||...|.:..|      |.|     ||.|....
Mouse   105 GAWSDRVG-RRPLLVLASLGLLL----QAVVSIFVVQLELHVGFFVLGRALC-----ALLGDFNG 159

  Fly   213 CLMAIYSYITIATPEEDRVFRFGIFAMFVTGVPFIGQPISGVLFTTLGYTWSFASAIVFQLIAIF 277
            .|.|.::.:...:....|.||..:....:.....:...:.|......||...|..|:...::...
Mouse   160 LLAASFASVADVSSNHSRTFRMALLEACIGVAGTLASLLGGHWLRAQGYANPFWLALALLIVMAL 224

  Fly   278 YIIFFIKEVKTTPTTSTTANEPPPLPTSLPPKQQGADNMAYETTNLDELQGNKNVNFQLTPQMEP 342
            |..|...|         |..||                   ::|.|..|:.::::         .
Mouse   225 YAAFCFGE---------TVKEP-------------------KSTRLFTLRHHRSI---------A 252

  Fly   343 KVEVVPPKRSLLKELFDPTLVLDCIRFPLVKRPNNGRMLLILLLCAYFLTVGPTSGENDYWYRFT 407
            ::.|||                         .|...||.|.|...|.|:.|....|..|....:.
Mouse   253 RLYVVP-------------------------APEKSRMHLALYSLAIFVVVTVHFGAQDILTLYE 292

  Fly   408 LK-KLAWNGNDFSIYLTLSSGAALVGTFIGTAILSKLLKVSDSMIGMLSALSIVCSRVLFAFSSS 471
            |. .|.|:..... |.:.:.....:.:.:|..:|...|  :|:.:..:.....:...|:|||::.
Mouse   293 LSAPLCWDSKLIG-YGSAAQHLPYLTSLLGLRLLQFCL--ADTWVAEIGLAFNILGMVVFAFATI 354

  Fly   472 TASFYVAGVVDMFVSL---RVIAIKTIGSSIVAGDELSKMYSIFGISEPIAQFIFPPIFSEIYKS 533
            |...: .|...:|:||   .||..|.  |.:|:..|...::|.......:|..:...||:.||.:
Mouse   355 TPLMF-TGYGLLFLSLVTTPVIRAKL--SKLVSESEQGALFSAVACVNSLAMLMASGIFNSIYPA 416

  Fly   534 TVDSFPGAIWLFGE-IFYIPNVLVFVV 559
            |::...|..:|.|. :.:||.:|:.|:
Mouse   417 TLNFMKGFPFLLGAGLLFIPAILIGVL 443

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31321NP_731899.1 MFS 141..>271 CDD:119392 29/123 (24%)
MFS_1 143..>271 CDD:284993 29/123 (24%)
MFS <379..559 CDD:119392 46/185 (25%)
Slc46a1NP_081016.2 MFS 73..443 CDD:119392 88/416 (21%)
MFS_1 94..407 CDD:284993 76/380 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C9581921
eggNOG 1 0.900 E1_KOG2816
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D333052at33208
OrthoFinder 1 1.000 FOG0000485
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23507
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.